ELF>@P?@8@!, ,  ,,  --``$$ ,,(Ptdx x x 22QtdRtd ,,00GNUf(ZEX`3J8o+%! V ֊h,$h48YŐ0 ”Xmb)|i@5 (,$ p * iV i;]  $ ;   U E  & c S ' F I y ] Nb?    /  D , 7   t~w R F")Y p 9 /  AM [OiF\   E    d=k/ W 6  } v _9X i=K l l $pUz y  axO  !6Jc y 6 6  !hc w$K P@T M&g  2? u  i pr F p  p^{ M K 04d PL p. 06 =* J __gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize_Jv_RegisterClassesCLRCreateInstanceCloseCLREnumerationCloseResumeHandleCreateDebuggingInterfaceFromVersionCreateDebuggingInterfaceFromVersionExCreateProcessForLaunchCreateVersionStringFromModuleEnumerateCLRsGetStartupNotificationEventRegisterForRuntimeStartupResumeProcessUnregisterForRuntimeStartup_Unwind_Resume_ZSt9terminatev_ZTVN10__cxxabiv117__class_type_infoE_ZTVN10__cxxabiv119__pointer_type_infoE_ZTVN10__cxxabiv120__si_class_type_infoE__cxa_begin_catch__cxa_end_catch__cxa_rethrow__gxx_personality_v0__stack_chk_failmemcmpmemsetstrrchr__cxa_allocate_exception__cxa_pure_virtual__cxa_throwmemcpymemmovestrlenstrncmptolowertoupper__cxa_call_unexpected_ZTVN10__cxxabiv121__vmi_class_type_infoEstrchrstrcmpfreemallocreallocstrdup__errno_locationbsearchisalnummktimeqsortrandisspacestrtolpthread_getspecificsnprintfvfprintfstrcasecmpstrncasecmpstrtouliswprintiswspacestrtodstrtoullfcntlfputspipestderr__tls_get_addrgetpagesizeposix_memalign__libc_current_sigrtmingetpidmmap64mprotectmunmappthread_killpthread_sigmasksigactionsigaddsetsigaltstacksigemptyset__xstat64chdirmkdirrmdir__fxstat64__lxstat64accesschmodfilenofsyncftruncate64lseek64realpathrenamestdinstdoutstrstrclock_gettimegmtime_rglob64globfree64getenvgetrlimit64getsidmemchrpthread_mutex_lockpthread_mutex_unlocksetrlimit64strerrorpthread_setspecificdladdrdlclosedlerrordlopendlsymbindtextdomaindgettext__cxa_free_exceptionmadvisepthread_selfsrandom__getdelimfclosefopen64strcpystrtollsysconffflushfwritepthread_key_createpthread_key_deletesyscallmrand48srand48sched_getcpusysinfogettimeofdaynanosleepgetegidgeteuidpthread_getaffinity_nppthread_setaffinity_npsched_getaffinityflockmkdtempsched_yieldpthread_cond_destroypthread_cond_initpthread_cond_signalpthread_cond_waitpthread_mutex_destroypthread_mutex_initpthread_mutex_consistentpthread_mutex_timedlockpthread_mutex_trylockpthread_mutexattr_destroypthread_mutexattr_initpthread_mutexattr_setpsharedpthread_mutexattr_setrobustpthread_mutexattr_settypepipe2pollpthread_cond_timedwaitpthread_condattr_destroypthread_condattr_initpthread_condattr_setclockwaitpidptraceabortdup2execveforkgetrusagemlockmunlockprctlsem_closesem_opensem_postsem_unlinksem_waitsigprocmaskpthread_attr_destroypthread_attr_getstackpthread_attr_initpthread_attr_setdetachstatepthread_attr_setstacksizepthread_createpthread_exitpthread_getattr_nppthread_getcpuclockidpthread_getschedparampthread_setschedparamsched_get_priority_maxsched_get_priority_minsem_destroysem_initmmap__fxstatdl_iterate_phdrstrcatstrncpy_IO_getc_IO_putcfdopenfeofferrorfputcfreadftellsetbufsetvbufungetcclearerrfgetsfseekgetcwdmkstemp64strtofisxdigitlocaleconv__ctype_get_mb_cur_maxwctombsigfillsetmsynclibgcc_s.so.1libpthread.so.0librt.so.1libdl.so.2libstdc++.so.6libm.so.6libc.so.6__environld-linux-x86-64.so.2libdbgshim.soV1.0GLIBC_2.2.5GCC_3.0GLIBC_2.3GLIBCXX_3.4CXXABI_1.3GLIBC_2.3.3GLIBC_2.3.4GLIBC_2.12GLIBC_2.3.2GLIBC_2.14GLIBC_2.4GLIBC_2.6GLIBC_2.9         m  *   ui /   P&y ;   ui /   ii C  0t) M ӯkY  `si d ti p | ri  ui /   ii  ti p ii  ii C ii  ui / ,Т,,,,0,,P,,, ,(,0,@,@,X,h,,x,,,,,,,,, ,,,, ,,,P,`(,0,P,@,X,`,8,x,,,p,@,,,0,,p,0,@,`,,,,,F,8,,(,`0,,@,,H,`P,X,0h,Pp,`x,p,, ,,,,@,,`,,0,, ,`,p,@,P,p, ,(,0,H,P,,`,,h,`p,x,0, ,P,`,p,, ,@, ,,,, ,,,@,0, ,,`,p ,(, 0,@8, @,H,P,`,,h,`p,x,0,0,,,p, ,0,P, ,,,,,,,,,(,8,,H,X, ,h,@x,@,,`,,, ,@,`,,,,,,`,,,,м,,,,  ,0(,@0,P8,p@,H,P,X,н`,h,p,x,,,, ,@,`,,,, ,@,`,,`,,,0,P,,0,P ,p(,0,8,@,0H,PP,pX,h,x,,,,, ,8,,@,8,,6,6,7,7,B7,X7(,x78,7H,7X,8h,(8x,F8,d8,8,8,8,9,B9,j9,~9,9,9(,:8,T:H,z:P,:`,:h,:p, ;x,4;,^;,;,;,<,<<,f<,<,<,,=,F=,`=(,~=8,=@,=H,=X,=h,=x,">,F>,d>,v>,>,>,>,>,?,$?,B? ,X?0,n?8,?@,?P,?`,?p,@,(@,X@,r@,@,@,@,@,@,@,A,*A ,HA(,fA8,|AH,AP,A`,Ah,Ap,I,B,B,&B,VB,lB,B,B,B,B,C,4C(,NC8,fCH,CX,Ch,Cx,D,(D,@D,dD,|D,D,D,D,E,:E,LE,rE(,E8,EH,EX,Yh,Fx,PF,F,F,F,F,G,G,0G,@G,ZG,G,G,G,H ,@H0,dH@,HP,H`,Hp,H,I,.I,DI,hI,I,I,I,I,*J,RJ,|J(,J8,JH,JX,Kh,@Kx,bK,K,K,K, ,> ,> -6? -? (-? 8-@ H-W@ X-@ h-@ x-&A -TA -B -dB -B -'C -qC -D -LD -D -D (-IE 8-E H-F X-F h-F x-?G -G -G -]H -H -H -eI -I -/J -MJ -J (-K 8-TK H-K X-K h-K x-3L -`L -L -L -L - M -FM - -]M -M -M (-M 8-M H-N X-jN h-N x-G -N -'O -fO -O -WP -uP -P -\Q -@R -S (- H1-z X1- h1- x1- 1-G 1- 1- 1- 1- 1-3 1-G 1-Z 2- 2- (2-9 82-l H2- X2- h2- x2-V 2- 2- 2- 2-- 2-m 2- 2- 2- 3-H 3- (3- 83- H3-R X3- h3- x3-1 3-{ 3- 3- 3- 3-^ 3- 3-1 3-Q 4- 4- (4-4 84-\ H4- X4- h4- x4- 4-6 4-H 4-\ 4- 4- 4- 4- 4- 5- 5- (5- 85-v H5-2 X5- h5-| x5-9 5- 5-K 5- 5-% 5- 5-5 5-2 5- 6-  6-M (6-! 86-! H6-# X6-# h6-!$ x6-`% 6-' 6-) 6-R* 6-, 6-- 6-/ 6-0 6-81 7-2 7-[3 (7-b5 87-7 H7-7 X7-@9 h7-9 x7-j; 7-< 7-= 7-= 7-n> 7-? 7-1? 7- 7->? 8-@ 8-(@ (8-^@ 88-@ H8-@ X8-A h8-9A x8-B 8-B 8-,B 8-IB 8-B 8-B 8- C 8-mC 8-C 9-C 9-C (9-D 89-DD H9-}D X9-D h9-D x9-E 9-4E 9-aE 9-E 9-E 9-E 9-E 9-F 9-BF :-cF :-F (:-G 8:- G H:-oG X:-G h:-H x:-H :-H :-H :-2I :-eI :-I :-9J :-J :-J ;-K ;-SK (;-K 8;-K H;-L X;-L h;-YL x;-L ;-L ;-HM ;-dM ;-M ;-N ;-SN ;-N ;-N <-O <-IO (<-O 8<-O H<-(P X<-P h<-P x<-BQ <-aQ <-Q <-Q <-nR <-R <-S <-S <-T =-DT =-T (=-U 8=-4U H=-NU X=-\U h=-mU x=-|U =-U =-U =--V =-gV =-V =- W =-YW =-W >-W >-X (>-aX 8>-X H>-Y X>-Y h>-Z x>-Z >-[ >-[ >-[ >-:\ >-\ >-\ >-L] >-] ?-^ ?-&_ (?-_ 8?-Y` H?-` X?- a h?-Za x?-ua ?-a ?-a ?-b ?-b ?-b ?-b ?-!c ?-c @-/d @-d (@-d 8@-Re H@-e X@-e h@-f x@-*f @-f @-g @-g @-h @-i @-{i @-i @-j A-k A-m (A-n 8A-:p HA-oq XA-r hA-r xA-r A-r A-s A-Rs A-s A-s A-t A-wt A-t B-"u B-Mu (B-u 8B-0v HB-v XB-v hB-7w xB-w B-dx B-y B-y B-y B-Pz B-${ B-{ B-| C-| C-} (C-Y} 8C-} HC-} XC-#~ hC-r~ xC-~ C-~ C- C- C- C-9 C-u C- C- D- D-9 (D-s 8D- HD- XD-9 hD-g xD- D- D-< D- D-Ѓ D- D-P D- D- E-ل E-; (E-u 8E- HE- XE-% hE-^ xE- E-ӆ E- E-= E-o E- E-؇ E-< E-] F- F-͈ (F- 8F-K HF-} XF- hF-K xF- F- F-6 F- F- F- F-o F- F- G-* G- (G- 8G- HG-Z XG- hG-ڎ xG- G-n G- G- G-G G- G-ɐ G- G-d H- H- (H-q 8H- HH- XH-C hH-h xH- H-ۓ H-b H-Ք H- H- H- H-ĕ H-ߕ I- I-? (I-e 8I- HI- XI- hI-͖ xI- I- I-E I-m I- I- I- I- I- J-; J-b (J- 8J- HJ-Ř XJ- hJ-L xJ-z J- J- J- J- J-8 J-T J-s J- K- K-ʚ (K- 8K- HK-D XK-^ hK-~ xK- K- K-\ K- K-Ԝ K- K-I K-[ K-o L- L- (L- 8L- HL- XL-5 hL-i xL-Ҟ L- L- L-& L-n L- L-ӟ L- L- M-" M-D (M-[ 8M- HM-ˠ XM- hM- xM-v M- M-p M-â M- M- M- M-< M- N-ӣ N- (N- 8N-g HN- XN- hN-դ xN- N- N-O N-c N-ĥ N-# N-} N- N- O-v O- (O- 8O-: HO-b XO- hO- xO-/ O-ȩ O- O-f O- O- O- O-Q O- P- P-Q (P-ά 8P-ܬ HP- XP-4 hP- xP-խ P- P- P-î P- P-Ѯ P- P-* P-; Q- Q- (Q- 8Q-J HQ-XQ-Q hQ-r xQ- Q-ư Q-( Q- Q- Q- Q-T Q- Q-˲ R- R-1 (R-h 8R- HR-8 XR- hR- xR- R-u R- R-K R- R- R- R-s R- S-p S- (S-s 8S-j HS- XS-# hS-j xS-$ S-Z S- S-U S- S- S-- S-X S- T- T- (T-% 8T-, HT-4 XT-Y hT- xT- T- T- T-@ T-j T- T- T- T-K U- U- (U-. 8U- HU-I XU- hU-8 xU-M U-y U- U- U-# U-t U- U- U- V- V-( (V-T 8V-w HV- XV- hV- xV- V-& V-5 V-s V-I V- V- V-" V-q W- W- (W-e 8W- HW- XW-! hW-V xW-w W- W- W- W-> W-V W-| W- W- X- X- (X- 8X-@ HX-` XX-v hX- xX- X- X- X-= X-^ X-~ X- X- X-D Y- Y- (Y-n 8Y- HY-> XY-p hY- xY- Y- Y- Y-S Y-p Y- Y- Y- Y-" Z-R Z-y (Z- 8Z- HZ-= XZ-u hZ- xZ-> Z- Z-) Z- Z- Z- Z-l* Z-* Z-* [-]+ [-+ ([-, 8[-b H[- X[- h[- x[- [-; [-Z [-m [-~ [- [- [- [-M \-s \- (\- 8\- H\- X\-5 h\-l x\- \- \- \- \- \-]. \-* \-G \-g ]-w ]- (]- 8]- H]- X]-< h]-N x]-] ]-{ ]- ]- ]- ]-? ]- ]- ]- ^- ^-? (^-k 8^- H^- X^- h^-E x^- ^- ^- ^- ^-^ ^- ^- ^- ^-3 _-h _- (_- 8_- H_-8 X_-g h_-g x_- _- _- _-; _-n _- _- _-0 _-k `- `- (`- 8`- H`- X`-< h`-S x`-w `- `- `- `-Z `- `- `- `-C a-y a- (a- 8a-8 Ha-q Xa- ha- xa-% a-S a- a- a- a-" a-b a- a-$ b-_ b-~ (b- 8b- Hb-- Xb-a hb- xb- b- b- b-I b-s b- b- b- b-8 c-q c- (c- 8c- Hc-l Xc- hc- xc-" c-J c-m c- c- c- c- c-T c- d- d- (d-4 8d-` Hd- Xd- hd- xd-7 d-R d-l d- d-X d- d- d- d- e- e-( (e-O 8e- He- Xe- he- xe-T e-r e- e- e-[ e- e- e-M e-j f- f- (f- 8f- Hf-! Xf-K hf-n xf- f- f- f-? f-Z f- f- f- f- g- g-6 (g-u 8g- Hg- Xg- hg- xg- g-7 g- g- g- g-  g-` g- g- h- h-  (h-" 8h-I Hh- Xh- hh- xh- h-- h-Q h-q h- h- h- h- h-  i-ci i-! (i-8 8i-Y Hi-p Xi- hi- xi- i- i- i-F i-Y i-k i-t i- i- j- j- (j- 8j-7 Hj-R Xj-r hj- xj- j-^n j- j- j-0 j-` j- j- j- k- k- (k-7 8k-U Hk- Xk-8q hk- xk- k-C k- k- k- k-( k-M k-l k- l- l- (l- 8l- Hl-9 Xl-k hl- xl- l- l- l- l- l-M l-f l- l- m- m- (m-% 8m-C Hm-g Xm- hm- xm- m- m-L m-r m- m- m- m-! m-C n-j n- (n- 8n- Hn- Xn-+ hn-^ xn- n- n- n-  n-P n- n- n- n- o-* o-Q (o-u 8o- Ho- Xo- ho-  xo- o-A o-z o- o- o- o-H o- o- p-d p-~ (p- 8p- Hp- Xp-? hp-g xp- p- p- p-Z p- p- p-# p-E p-w q- q- (q- 8q- Hq-! Xq-R hq- xq- q- q-  q-< q-o q- q- q- q- r- r-) (r-L 8r- Hr-h Xr- hr- xr- r- r- r-2 r-F r- r-] r-~ r- s- s- (s- 8s-1 Hs-a Xs- hs- xs- s-% s-J s-m s- s-u s- s- s- t- t-/ (t-I 8t-` Ht- Xt- ht-" xt-U t- t- t- t-j! t-! t-g" t-" t-" u-" u-# (u-B# 8u-# Hu-# Xu-$ hu-)$ xu-Y$ u-$ u-M% u-v% u-% u-& u-<& u-& u-& v-& v-%' (v-q' 8v-( Hv-2( Xv-Z( hv-( xv-( v-P) v-) v-) v-'* v-B* v-8 v-}* v-* w-* w-+ (w-4+ 8w-+ Hw-, Xw-", hw-J, xw-|, w-, w-, w- - w--- w-K- w-- w-. w-d. x- x-. (x-. 8x- / Hx--/ Xx-l/ hx-/ xx-/ x-/ x-0 x--0 x-N0 x-|0 x-0 x-0 x-+1 y-P1 y-1 (y-1 8y-1 Hy-22 Xy-P2 hy-2 xy-2 y-3 y-&3 y-G3 y-ɕ y- y-e3 y-3 y-3 z-3 z-3 (z-H 8z-4 Hz- Xz-$4 hz-B4 xz-_4 z-x4 z-4 z-4 z-?5 z-g5 z-5 z-5 z-5 {- {-ߘ ({- 8{-6 H{-,6 X{-Z6 h{-x6 x{-6 {-6 {-6 {-7 {-7 {-B7 {-5 {-W7 {-7 |-7 |-7 (|-7 8|-R H|-t X|- h|- x|-ќ |- |- |-( |-; |-T |-z |- |- }-؝ }- (}- 8}-) H}-F X}-U h}-t x}- }- }-͞ }-7 }-7 }-7 }-#8 }-_8 }-8 ~-8 ~-8 (~-8 8~-9 H~-09 X~-X9 h~-9 x~-9 ~-X9 ~-9 ~-: ~-$: ~-:: ~-Q: ~-h: ~-: -: -; (-H; 8-r H-; X-; h-; x-; -< -:< -f< -< -< -< -< -"= -P= -d= (-= 8-= H-)> X-X> h-w> x-> -@? -? -? -? Ȁ- @ ؀-"@ -g@ -@ -@ -2A (-}A 8-A H-aB X-wB h-B x-C -;C -zC -C -C ȁ-C ؁-D -JD -qD -D -D (-E 8-6E H-jE X-E h-E x-F -F - - - Ȃ-4 ؂-_ -s -2F -cF -xF (-F 8-F H- X-K h-{ x- - - -# -O ȃ-y ؃- - - -F - (-F 8-F H-G X- h- x-AG -kG -A -T -k Ȅ- ؄- - - - -7 (-P 8-w H- X- h- x-' -X - - - ȅ- ؅-% -Z -G - - (- 8- H- X-, h-9 x-V -z - - - Ȇ- ؆-9 -V - - - (- 8-4 H-^ X- h- x- - - -7 -Q ȇ-q ؇- - - -7 -a (-| 8- H-G X- h- x-7 -W -l - - Ȉ- ؈- - - -3 -] (- 8- H- X- h- x- -) -^ - - ȉ- ؉- - -0 -C -T (-c 8-v H-G X- h- x- - -* -K -x Ȋ- ؊- -H -\H -Z - (- 8- H- X-C h-u x- - -f - - ȋ- ؋-> -z - - - (-G 8- H- X- h- x-3 -G -Z -H -H Ȍ-9 ،-l - - - -V (- 8- H- X-- h-m x- -2I -fI -H - ȍ- ؍- -R - - -1 (-{ 8- H- X- h-^ x- -1 -Q - -I Ȏ-4 ؎-\ - - - - (-6 8-H H-\ X-I h-J x-RJ -J -J -J - ȏ-K ؏-4K -VK -qK -K -K (-K 8-K H-L X-@L h-hL x-L -L -L -M -6M Ȑ- ؐ-LM -M -M -M -M (-M 8-N H--N X-چ h-PN x-xN -N -N -N -N ȑ-f ؑ-O -@O -pO -O -O (- P 8-MP H-P X- h-P x-Q - -cQ -Q -Q Ȓ- R ؒ-8R - -{R -R -a (- 8- H-' X-u h-R x-,S -_S -S -S - ȓ-S ؓ-S -,T -{T -T -T (-J 8-o H- X-T h-NU x-y -U -U -U -V Ȕ-dV ؔ-V -V -W -1W -eW (-W 8-W H-W X-+X h-TX x-yX -X -X -[Y -Y ȕ-Y ؕ-$Z -EZ -|Z -Z -[ (-u[ 8-[ H-\ X-:\ h-p\ x-\ -\ -#] -\] -] Ȗ-] ؖ-^ -L^ -^ -^ -_ (-b_ 8-_ H-_ X-_ h-A` x-x` -` - a -Ja -a ȗ-a ؗ-b -Cb -b -b -?c (-c 8-c H-6d X-vd h-d x-d -2e -qe -e -e Ș-If ؘ-tf -f -f -f -g (-Gg 8-og H-~g X-g h-g x-g -g -g -h -h ș-4h ؙ-Yh -vh -h -h -h (-i 8-^i H-i X-i h-i x-5j -j - k -:k -ck Ț-k ؚ-k -1l -fl -l -l (-m 8-Nm H-m X-m h-m x-)n -nn -n -n -n ț-Eo ؛-\o -o -4p -}p -p (-p 8-#q H-=q X-rq h-q x-q -8r -br -r -r Ȝ-r ؜-%s -P,x-8>/--%,h?%,h@%,hA%,hB%,hC%,hD%,hE%,hF%z,hGp%r,hH`%j,hIP%b,hJ@%Z,hK0%R,hL %J,hM%B,hN%:,hO%2,hP%*,hQ%",hR%,hS%,hT% ,hU%,hV% ,hWp% ,hX`% ,hYP% ,hZ@% ,h[0% ,h\ % ,h]% ,h^% ,h_% ,h`% ,ha% ,hb% ,hc% ,hd% ,he% ,hf%z ,hgp%r ,hh`%j ,hiP%b ,hj@%Z ,hk0%R ,hl %J ,hm%B ,hn%: ,ho%2 ,hp%* ,hq%" ,hr% ,hs% ,ht% ,hu% ,hv% ,hwp% ,hx`% ,hyP% ,hz@% ,h{0% ,h| % ,h}% ,h~% ,h% ,h% ,h% ,h% ,h% ,h% ,h% ,h%z ,hp%r ,h`%j ,hP%b ,h@%Z ,h0%R ,h %J ,h%B ,h%: ,h%2 ,h%* ,h%" ,h% ,h% ,h% ,h% ,h% ,hp% ,h`% ,hP% ,h@% ,h0% ,h % ,h% ,h% ,h% ,h% ,h% ,h% ,h% ,h% ,h% ,h%z ,hp%r ,h`%j ,hP%b ,h@%Z ,h0%R ,h %J ,h%B ,h%: ,h%2 ,h%* ,h%" ,h% ,h% ,h% ,h% ,h% ,hp% ,h`% ,hP% ,h@% ,h0% ,h % ,h% ,h% ,h% ,h% ,h% ,h% ,h% ,h% ,h% ,h%z ,hp%r ,h`%j ,hP%b ,h@%Z ,h0%R ,h %J ,h%B ,h%: ,h%2 ,h%* ,h%" ,h% ,h% ,h% ,h% ,h% ,hp% ,h`% ,hPH-H `HHH@@W@ @0 H DaHH8( @@(@P@`@dH -HA(H=-H-HH@ f@ÐH1-H \VHHH 1WHH@H oWHH H WHH(@0H@8(4@@(_@P@`@dH -HA0H=-S-fH-H5-H.-H ,H H ,H HY-H@8@@W@@@ @0( <HD(<PT@dH G-HAHd-H@8@@@@@ @0HDfn@T@dHH=-H5 ,.f.@Hi-W@@@ @0@8@H(;@L@\@`@dH x-HA H=u-cUHSPHk-W@@@ @0@8@H@L@P@T@XH -HCH=~-H}-H HHH@@W@ @0@8@H( ;@L@\@`@dHCH=-H={-H5,H[]UHH=-H5~,H=-H5,]{f.UHH-W@@@ @0 H@8(=@@(:@P@`@dH Ù-HA@H=-Ho-Hj-H]ÐH-H&- H HHH HH@W@ @0@8@H(9@L@\@`@dH -HAHH= - fDHX,H=J,UH)HHw]HL+Ht]@H!,H=,UH)HHHH?HHu]H+Ht]H@= ,u'H=+UHt H=4+-h] ,@f.H=`4+t&H+HtUH=J4+H]WKf.UHAWAVAUATSHMMH8IAHdH%(HE@W)EHE)E)E)p)`)P)@HEDž@hE1EAAHEL@111E1HPAR8AUkH t H}HtEA$HEI1*A$IOH NdH %(H;MuHĨ[A\A]A^A_]UHSPH@u,H?1uڮ NH[]@UHSPH@u+H1u蒮苮 NH[]DUHAWAVAUATSPIIIA!@MWML}H5&I H$Iǻ1MtiAEgMwMoLHIGH5DLLt)؁NظA1Ƀu LR$1HEHH[A\A]A^A_]UHAVSIA@u'1Mt I~AuL#[A^]f.UHSPH@uWHt H@H[]f.UHAWAVAUATSHIIHAdH%(HEA@HAWMHPM1D9IMA@|LhHH@LeLpDAvE1E1ffff.HݐLpAHL9rE:DLXDHiH5FI2"AHE11HLI4HHIH`HHxLLHHH݈MLtHL HHHBAH`JH݈LSHJAE9Ms H;XH[rE9DHLELpLhH`HAELP1I11IM!HxHHT1I9sHHDH9LXIAIIA{1H ryHHxHDpHt pHWL)1DؐLؠDސLޠDذLDްLDLDLD D H[HuHt:HHHDHxHTHB @H H HuM9LHLXIAU)D)ƃrnHxHD8Ht 8EA)H\H\H\H\H\H\H\H\H\H\H\H\H\H\HHHA9uHHHHxHHHHHuHPHHhHHp~~vDAfdA\E1LLpLhL0LpLhHH`E1L LHHPHIE(E1IMt uL[dH%(H;EuDHĘ[A\A]A^A_]H MHItLHH fUHAWAVSH8dH%(HEfDžHHt[fE/HHt0H/HHH/HHuH55Ht18H&H++HHH&H&dH%(H;EuH8[A^A_]gHIHu&HIE1u*LHE1II LiHHuH@LL4F@=t#H ^5@A1FMMEIH@LЉMtLT,H4SH HMtL!,Hu4 H[ HH{HC UHAWAVATSAII@u DIƻWL9u1MtL\A^A_]UHAWAVAUATSH'MAIIldH%(HE@WMME0MtA#1A#zCMEA#Hp$Hf(+HHpHpO$1lHeHH@H`HE@@BLPAE1HHXfJH`Ht.fDžHLw 1ɅuJHX $<u IM9rLPHXE1LEH`HtMt(H+H1۹1LLDlMHp"dH%(H;EuHĈ'[A\A]A^A_]@U4蠢 藢莢04HvHI0HIHIH`t H`Hp*"E1u2LHE1JIr'HILxIHH^uH@HH0aB@t#H 1@Ar1MIEHH@HЉMtL (H]0lH;HMtL'H/0 HHH5Hffff.UHAWAVAUATSHIHAdH%(HEA@HDžHMHAWE1HE1C;E1C";zH+H0E1HHL1HA@?HxH-$+HHxHx Dž`DždDžhHaQHpDžHDžLDžPHXLH`LV1>IHLLH/HHH)HH`HމHWH'.HDHDžH`HH`HH1cltHHtHHHHVIMt uLH`_Hp11IPtHXHt'htHpHt HxMH5T-LHAKHHHDAE AW@X/@N/DH:8HIHIHItHHt JHIIMtuLH0HIPtHXHthtHpHtHxE1u*LZHE1I"IxL0HHuH@D=HHN+=@誱t#H +@Ae1賱MIEHH@HAMtL"H+E1AtA+t A<E1HHtHPHDžMtLHIdH%(H;EuDHĘ[A\A]A^A_]TH|HMtL"Hp* HVHHvH>fffff.UHAVSIHt @[A^]ÿHL[A^] fff.UHAWAVATSIII@@MH5u&LX@ujH5H&L;uRH55 Ht7H %H +HQH@@ HLL[A\A^A_]a[A\A^A_]f.HHHHHf.fPzDUHAWAVATSH IHIdH%(HEHDžHM/HAW1HbHH)H1D LLLHH=u|A1ɅEA"ƅjHH)H@TτtIHtHTHHuD,HHuEƅE1 111'H1@5tS5tN5tO5tRHHHHHuƅE1 111`H HHHHHHH51H5A'D2t"HH9uƅE1 111SE1HHA<1HtYH5&IHIAKMt6IAvHLAE1xHIFIvE11HEHyhLLH:eIHzAuH@A@HtHIv1DAVdH%(H;EuH [A\A^A_]gHOHHf.Df.UHSPHCtH詖uHWCtsHv@Ct)u H+tHbuHFWKуHHCH[]@UHAWAVAUATSHxLhMIHxHpH]LudH%(HEHDžHDžHDžHDžHDžH1"H1LH E AMMuA@E_HtAHf;OHxHH5d*HAE"H*H *E1H1HNH #H1HH]-EIEH5*HLx}HHHL11PCLu2HH"H1HAEہIEHL11LPLuxDHHt8IEH1L11LPHCDمHIACxgHHHL11PHHCDمHمx-HHuA؁ENHHPIxVHHtJHH5m(`HHHM H $HpHxLLhMЉÅxTI>AHH57(HtsHHM H $HpHxLLhMAHH5'HAHtaHHHfFHH5'zACHt(HHpHxHhMLM AH]HtEy D=Gu fHCHHt莲HHt}HHtHPdH%(H;EuDHx[A\A]A^A_]fUHAWAVAUATSPMMHLeH}0u8L-&H &1LuH 1LLHCAAHE HE(1H[A\A]A^A_]@=hSM2=%ڡKtU=Ktn=hhSM:`qM=hSMt3=RMtQ=(Mu^:uV{KNÁ:uA(qM3:u1OqM#:u!1H[A^A_]ffff.GUHSP_Ht uHP0H[]fDf.Df.UHAWAVSHIAdH%(HEH+HuwH=+Hu[H+H8Hu1H +HpfHnHfHnflH=+fH8HH5NHUH}H=+HP8HH}+H=+Hu[Hz+H8Hu1H K+HpfHnHfHnflH=[+fH8HH5HUH}H=F+HHDLPPdH %(H;Mu H[A^A_]UHHdH%(HEH=+Hu[H+H8Hu1H +HpfHnHfHnflH=+fH8HH5%HUH}H=+HP8dH %(H;MuH]@UHAWAVSHIAHdH%(HE1uvH=@+Hu[H+H8Hu1H +HpfHnHfHnflH=+fH8HH5qHUH}H=+HHDLPPdH %(H;Mu H[A^A_]"fUHAWAVSHIAdH%(HEHa+HuwH=}+Hu[HQ+H8Hu1H "+HpfHnHfHnflH=2+fH8HH5HUH}H=+HP8HH+H=+Hu[H+H8Hu1H +HpfHnHfHnflH=+fH8HH57HUH}H=+HHDLPXdH %(H;Mu H[A^A_]UHAWAVSHIAHdH%(HEH=F+Hu[H+H8Hu1H +HpfHnHfHnflH=+fH8HH5wHUH}H=+HHDLPXdH %(H;Mu H[A^A_](UHAVSHL5+I>Hu _HI>1H_Ht[A^]UHAVSHL5g+I>Hu _HI>1H_Ht[A^]cUHAVSHL5'+I>Hu b_HI>1Hb_[A^]HDUHAVSHL5+I>Hu "_HI>1H"_[A^]HUDUHAVSHHt$L5+I>Hu ^HI>1HM_[A^]HUHAVSHHt$L5j+I>Hu ^HI>1H _[A^]HH +HHu1H+HpfHnHfHnflH+fHffffff.UHHdH%(HEH+Hu[H+H8Hu1H i+HpfHnHfHnflH=y+fH8HH5HUHEHd+dH %(H;MuH]f.H+H8tH8H`fIH+H:Hu1H5+HpfHnHfHnflH=+fH:HHBLffff.H+H8Hu1H j+HpfHnHfHnflH=z+fH8H` f.AHF+H Hu1H +HpfHnHfHnflH '+f H HHBH1HDf.HH +H9Hu1H+HpfHnHfHnflH=+fH9UHHHQP1]fff.HH +H9Hu1HW+HpfHnHfHnflH=g+fH9HHIXHHH 6+H9Hu1H+HpfHnHfHnflH=+fH9HHI`HᐉH +H9Hu1H+HpfHnHfHnflH=+fH9HHIhH +H9Hu1Hh+HpfHnHfHnflH=x+fH9HHIpHH F+H9Hu1H+HpfHnHfHnflH='+fH9HHIxHHH +H9Hu1H +HpfHnHfHnflH=+fH9HHHfffff.HH +H9Hu1Hg +HpfHnHfHnflH=w+fH9HHHfffff.AщHL1+I8Hu1H= +HpfHnHfHnflH=+fI8H7HH։D@AH+H:Hu1H5 +HpfHnHfHnflH=+fH:HHDf.HH v+H9Hu1HG +HpfHnHfHnflH=W+fH9HHHfffff.IщHL+I8Hu1H= +HpfHnHfHnflH=+fI8H7HH։L@AщHL+I8Hu1H= +HpfHnHfHnflH=+fI8H7HH։D@IщHLQ+I8Hu1H=" +HpfHnHfHnflH=2+fI8H7HH։L@HH +H9Hu1H +HpfHnHfHnflH=+fH9HHHfffff.HH +H9Hu1Hg +HpfHnHfHnflH=w+fH9HHHfffff.AщHL1+I8Hu1H= +HpfHnHfHnflH=+fI8H7HH։D@AH+H:Hu1H5 +HpfHnHfHnflH=+fH:HHDf.UHAWAVATSHAAIHdH%(HEH=q+Hu[HE+H8Hu1H  +HpfHnHfHnflH=&+fH8HH5 HUH}H=+HHLDEPdH %(H;Mu H[A\A^A_]Nfffff.UHAWAVSHAIHdH%(HEH=+Hu[Hz+H8Hu1H K+HpfHnHfHnflH=[+fH8HH5 HUH}H=F+HHLDP dH %(H;Mu H[A^A_]UHAWAVSHIIHdH%(HEH=+Hu[H+H8Hu1H +HpfHnHfHnflH=+fH8HH5 HUH}H=+HHLLP(dH %(H;Mu H[A^A_]UHAWAVATSHIAIHdH%(HEH=!+Hu[H+H8Hu1H +HpfHnHfHnflH=+fH8HH5RHUH}H=+HHLDMP0dH %(H;Mu H[A\A^A_]fffff.UHAWAVSHIIdH%(HEH=W+Hu[H++H8Hu1H +HpfHnHfHnflH= +fH8HH5HUH}H=+HLLP@dH %(H;Mu H[A^A_]:f.UHSHHdH%(HEH=+Hu[Ht+H8Hu1H E+HpfHnHfHnflH=U+fH8HH5HUH}H=@+HHPHdH %(H;MuH[]fff.UHAWAVSHIAHdH%(HEH=+Hu[H+H8Hu1H +HpfHnHfHnflH=+fH8HH5HUH}H=+HHDLP`dH %(H;Mu H[A^A_]ȿUHHdH%(HEH=4+Hu[H+H8Hu1H +HpfHnHfHnflH=+fH8HH5eHUH}H=+HPhdH %(H;MuH]$@HH +H9Hu1HW+HpfHnHfHnflH=g+fH9HHHf.@H q+HHu1H2+HH_+HX+HU+S+Hffffff.H !+HHu1H*HH+H+H++Hffffff.UHAVSHHt HHPXt[A^]HLpIHL[A^]@UHSPHHPHH[]UHAWAVSH(HAdH%(HEEEEHD*HEH5eH}`.EШuND}ȋSD9s 1HD"D;CtsH"L{H{Hu؋UKEHKu SD}D9stH{HtEL{HMȉ H KHMHKCƒ AtH}Ht1DHtdH%(H;Eu H([A^A_]腼HEtH}HtHĿ@UHSPHHPH рuHHQHH[]iHHHH[] @UHAWAVSPHHP`IH{Ht HH@PIGLH[A^A_]IMt ILPLffff.UHAWAVATSH HdH%(HEHDžHDžDžfDžHH@ Hп0IHH@HIGAGH*HIAGAGAG H'IG(u/LHDAvA1HDH AG Ewu+:HAOH AOHIO(AG 4D3AwH I(H:AO ƒ AO tHHtZdH%(H;EuLH [A\A^A_]IAG tI(HtH*HII_Ht4HH@XHЅu$HL`IHL HILItHHtLUHAWAVSPHHPhIH{Ht IGLH[A^A_]IMt ILPL葼UHHP1=0]UHHP"~AtItAt99w r"tttu]1]"~AtItAt98w r"tttu1fD1ffff.UHSPHHPXtHHP8= MOO1H[]fffff.#wYH HcHHVÁV tatauqH8ÁWtQtUuXHÁuHHH"H(H3H3H2HHH1ÐGfff.UHSPHC=RCCuRCC{(uyH;CPuC0CH[]UHSPH1;RCCu{uRyH1H;K@H[]ffffff.1ffff.UHAVSIHSRCCu0RCC{(u)xH;CPuHHPL[A^]kStH511L[A^]oaH521L[A^]Zaf.H)*HHHfHnfsGff.UHAWAVSPHH*HHLsIFHr'IH@XLЅuILxMLLPHCHi*HHH[HtHH@XHЅt H[A^A_]HLpIHLH[A^A_]IH:L2H*f.UHSPH"HH[]@UHSPHHCHuHHHHH[]UHSPHH{HuHHHZH;Ht HH[]`@H[]f.UHSPHH{HuHHH H;Ht HH[]`(1H[]ffff.UHAVSIHH{HuHHHH;HtHH@ L[A^]H51L[A^] _fUHAWAVSPHHP`IH{Ht HH@PIGH{HGHsI HH@PIGLH[A^A_]IMt ILPL芶f.UHAVSH@脃t LcH 2@1萃t u @IIFH*HIA^@t.LcH$VH @A RH1蘲L0H5>*1Ht@UHH+eH +HHu1H*HH+H+H++HHH5*1HUHAWAVATSHI@-t LcH @19t u 8@0IIIGA_H*HIAGAGAG HIG(IL@莁t7ILPLcH$hH = @A RH1胁 L8H5*1HIAG tI(HtH*HII_Ht'HH@XHЅuHL`IHL?L7L诳HwUHAWAVATSH t u @EEEL5LuH}Ⱦ0IIGA_Ho*HIAGAGAG Mw(EШu,LHDuAv;1HDAG Ewu%4HMAOH AOHMIO(AG +D3AwHI(Hu؋UAO EЃ AO @t:IH@LLcH$~H 4 @A RH1zL8H5*1HܯIAG tI(HtH*HII_Ht'HH@XHЅuHL`IHL6L. HtIEtH}HtKL胱UHu Nljfffff.UHiUHAWAVATSHHt,)@)P)`)p)e)m)u)}L8L0H(H HHDžHDžDžfDžHHEHEHEE0EHHUHY0HHCC@H*HHCCC HHC(u.IIDAv=1LDC D{u(6HKH KHHK(C 2E>sLH{(HK  K @|t:HH@HLcH$H G@A RH1|HH5*1HIC tH{(HtH*HHL{Mt'IH@XLЅuIL`MLLJHB HItHHtYL葮UHAVSHE1HH+HHu1H *HH +H +H++HH9ttHMIILP==~<=tZ=tS=u5Jw r5=t.=u%=t=tL[A^]ÿ藪H 航L0H5^*1Hd@UHAWAVAUATSHAIAdH%(HEDžHDžLDžPL%LXH5 HHPu HAWYAOuAWH9sBtIHt PI_HHAH AOHXIOAGO9s 1LAAGtAwLI_IHXHAOPƒ щ tHXHtDžHDžLDžPLXD%=u(Aց/w`HHAFHj+LHHHADAQAQAQAQAQAQAQAQAQ_HPAA+ADwmH xHcHL-DAV(AtrAtrAL-zAWt\Et`AucL-[]AuQL-QKL-zBL-9L-0L-'L-L-eL-7 L-E1EL HEUHuHH1L0EtgHHDEEH]ELHEUHuHM1L/EtH}HtEEEHmHEH} L^HEUHuHM1LE/H5&1LDq\MtH51LLX\EttH HD`dHpDžhLHxUHxH`1L.htHpHtEtH}HtPtHXHtdH%(H;EuHĘ[A\A]A^A_]{iHEt|H}HtslHPtHXHtsl9Hht5HpHt)L"HPtDHXHt81HHEtH}HtPtHXHtH2fUHAWAVSPHL=T+AHt LHHQ(IAHt HHHQ(HCL3H[A^A_]ffffff.UHHݳ+Ht HHHQ(]UHH+Ht H`HHQ(=]fD1RCC@UHSPHWCHC PfHC H[]UHSPHWCCH3$fHC H[]@UHSPH193u{ueH1H;K@H[]UHH0dH%(HEW)E)EeHEHMпRCC1dH%(H;EuH0]آUHAVSH*HHH_HtHH@XHЅt[A^]HLpIHL[A^]bHf.UHAWAVSPIHd*HII^Ht'HH@XHЅuHLxIHLLH[A^A_]H;f.HHtUHHP]1f.1f.1f.1TOOR@H``f.UHAWAVSPIH*HII^Ht'HH@XHЅuHLxIHL%LH[A^A_]H[f.f.HHH^f.@ MOOf. MOOTOORUHHHP81= MOO]DGf.fUHAWAVSPIH*HII^Ht'HH@XHЅuHLxIHL%LH[A^A_]H[f. RHf. RHTOORUHAVSHIHHP8= RHuHHPA;F1[A^]UHSPH}KH@H*HHHH[]f.UHAVSHH*HHC tH{(HtdHE*HHH[HtHH@XHЅt[A^]HLpIHL[A^]H%DUHAWAVSPHH*HHC tH{(HtH*HHLsMt'IH@XLЅuILxMLLcHH[A^A_]QH虿fUHAWAVATSI0(HAFIvHCCH*HHCCC H HC(H{H[A\A^A_]IC tH{(HtH*HHL{Mt'IH@XLЅuIL`MLLzHrLH貾fUHAWAVSPIHt*HII^Ht'HH@XHЅuHLxIHLLH[A^A_]HKf. HESf. HESTOORUHAVSHIHHP8= HESuHHPILP91[A^]f.@UHAVSI\HIvHCH*HHH{1H[A^]fUHSPHH{Ht HPuH{Ht HP1H[]ø LEDf. LEDTOORUHAVSHIHHP8= LEDuHHPILP91[A^]f.@UHRH *HHHfHnfs@]f.fUHAWAVSPIHAFuE>SCKu SE>D9s0tH{Ht AFI H KINHKC>D9s 1HDKD;CtsH2H{IvArCHKAV% ЉH[A^A_]UHAWAVATSAAHE1Et$D|IAuHt HsLCtH{HtKCEL{DsDC[A\A^A_]UHAWAVAUATSH(AIHM.I^EA )II)9CB<LH A)EG ,D9ZCI1Hu}LMUt6LEȉEtHHLI8LHuLEȋ}LMUANt+Ht&HLIWULLM}IHuAN˃IFAVD˃AND)t)HIcH߉IHL謗ILM.LH ED91Et-LEIDHEtIvDHcLLEAFtI~HtIMMLAFEI^EfDAF:HEDHHA)t0IvIcHDH([A\A]A^A_]I^E&DHHH([A\A]A^A_]fUHЉ1ʉ]DЉ1ʉUHAWAVAUATSHHAAIIdH%(HEMu<IŻ@MSEH}kH*HHEH}AANрu 1L fff.IFEANрALMLDDHÁzuu&fx,uAAFр9|1L LhtL*RuLE~AtAvLE~MfLAADHILeD}HuLnLAN H}HdH%(H;EuHH[A\A]A^A_]HIHIH}E1u*L舘HE1(IPI覗L^/HHDuH@rkH}M@et#H @A]1eMtL H}a @H:HMtLH}1 HHϖH7Hf.DUHAVSH dH%(HEL5+A>ulHuЉ)t}u H(+X+HQ+K+H H I+H *+H-+AdH%(H;Eu H [A^]fH +1H9ffffff.UHAWAVAUATSHIIIDEt 1L9^EDEHUfE7A<$ED)t*fEt$t.fǀt+脌0ffffff.D tT1KG_CfAƀt D?AEAEACDEHU)øIII9ԉPff.E7IA<$IED)t"fEttfǀt輋D tBG_CfAƀt D舋AEAEACDE)uH[A\A]A^A_]@UHAVSHIdH%(HELEAL5t}AuAN ىdH %(H;Mu H[A^]ˑff.UHAWAVAUATSH(IHdH%(HEЉHEt E1H9DMDEHuf.D+EE<$AtNEtIA |cA |]E8t*DAUACAǟHAB)AMHI-A)DD 0HIfDAH+8t9At,AtHCH;EAA}DD1AHDLEt}|D&D+AuAACD A1ALDLETt}'"A$AuAL$ ى@DMDEHuDA)uHIE1EjH9adH%(H;EuDH([A\A]A^A_]諏ff.UHAWAVSPIMIw#GȉfCffffff.;1M9rH[A^A_]ffff.UHAVSHIHtef;t_H蠺1L?IFAANрH14Sf4PftfHH9uaAFANuAIFf4tI~HtAAFHIFAF[A^]H9uf 111[A^]ffffff.UHSPHCKuHCf1tH{HtCHHCCH[]ffffff.UHAVSIANσtp A~^9A~A9^sLމA~A@tAvLAA~IF@u$fDWA~uAIFfIw#GȉfCffffff.y1M9rDHs;$H>H9AAudC"LH)DN€Ÿs1D<sAHA1HuMtʀŸs1ÉH[A^A_]ffffff.UHAWAVSPIIAWtX@u;IGA7рHff.HH9s8yH9t@AWLAW AWtAwLAWII+_ANHLHIGIAGЃAFH[A^A_]ÐUHAVSIH3Kрu&AFANuuAIFf1L9LHCKрHH9wcA6ANрHIv@ fHHH9v4tI~HtjAAFHIFAF[A^]Wу9tVtR1tPtKtA@uAHwDрAAIHL9s>yL9t@WÃWUHAWAVATSIHKȃ1҄uAAHHcHAFANAIFfHL[A\A^A_];LH[A\A^A_]E1HSр1E1E1D&AEt}Dκ1LJHSKрMF1DEu9tI~Ht̮AAFHVIFAF[A\A^A_]fff.UHAWAVATSH IHdH%(HE؋CʀIE1Ht+SIԀht?@u;HS3рH fHH9s:yH9!@CHDžHDžDžfDžHHuVDSD9s 1HDD;CtsHH{H zKPKuSDD9stH{Ht &H H KHHKCƒ щKt'HHt۬CHHI>tMLcM&CЃAFdH%(H;EuH [A\A^A_]ezHtHHthH}UHAWAVSPIHKȃ1҄u2HHcHLHH[A^A_]ffff.AFANAIFfH;ttHHtqdH%(H;Eu.H([A\A]A^A_]ÃAEiuHtHHtHHxUHAWAVSPHIHOtuL{bDCDriL{t?A@u9HsDрH fHH9s>yH9t6A@EHA $<tHLLHH[A^A_]AAEff.UHAWAVAUATSH8IHdH%(HEHDžHDžDžfDžC$<t<uLrxff.Br~LrtD@u@Hz2рHfffff.HH9s?yH9@AHLILA $<tLHLVLDkD1ɄH HcHD:JрAALM4$D#AADAALcM)M9HZfff.LHL2lIM9vffff.JрD*ILIDrHHLAADAAE7AOрAAMLMwKD-I)HL9Lw7HpHLuLIH@ЃAG1tHHt衣dH%(H;Eu7H8[A\A]A^A_]HL0Dh뮃A86qHtHHt5Hmtffff.UHAWAVAUATSPAIIfAĀt LLfAME1ȃEu5HHcHIIUAuуHT2f.fffff.HH9wT0D9uIAN=ILIEAUAMуHDPHH9wfD9#uIANADH[A\A]A^A_]fUHAWAVAUATSH(IHdH%(HEHDžHDžDžfDžC$<t<uLrxff.Br~LrtD@u@Hz2рHfffff.HH9s?yH9@AHLILA $<tLHLVLDsD1ɄH HcHD*JрAALcAADLL)LIH9HGL9LzfDHLL2hHL9sffff.JрuzzD*JрAALL{HAADIGKD-H)IHH9HGL9r+fIHrHLt`HL9Ls1tHHtҟdH%(H;EuTH([A\A]A^A_]HHDpIH@ЃAF둃ALJmHtHHtKHpUHAWAVSPAIHfAǀt HLK1ʃuH9HGfff.fffff.HH9rS>D9u=HS3уHtrI>H9HGfffff.HH9rfD9>uI6ANH[A^A_]f.UHAVSH IHdH%(HECt>@u/HS3рHHH9s:yH9tH@CHPCЃHKHM؉EHuHL.dH %(H;MuH [A^]ÃCkfDUHAWAVAUATSH(IIIdH%(HEHDžHDžDžfDžAF$<t<u MeoAEryMetD@u@IUAuрHff.HH9s:yH9@A$LL(A$ $<tLLLML/(I?H)HAUAMр9s1MAF1Ʉu.H uHcHIucffffff.Iu#tHHtdH%(H;Eu$H([A\A]A^A_]ÃA$:iHtHHt諛HlUHAVSH IHdH%(HECt>@u/HS3рHHH9s:yH9tH@CHCЃHKHM؉EHuHL.dH %(H;MuH [A^]ÃChfDUHAWAVAUATSH(IHIdH%(HEHDžHDžDžfDžAG$<t<u MfoAFryMftD@u@IVA6рHfff.HH9s:yH9@A$LHxA$ $<tLLLML%L#L)HAANр9s1AG1ɄH HcHI DL9MnHfff.E}A<$ED)t)fEt#tffǀt#`#fffff.tCTG_CfAǀt D_AFAFACH)uIII9h1ۅfIvE1ALtHHt蚘dH%(H;Eu$H([A\A]A^A_]ÃA$BfHtHHtAHyifUHAVSH IHdH%(HECt>@u/HS3рHHH9s:yH9tH@CH0CЃHKHM؉EHuHLdH %(H;MuH [A^]ÃCfefDUHAWAVAUATSHIIdH%(HEAFt]u H t+ tF@u6IVA6рHfHH9s:yH9u@AFL[AFA$AEtku H at+ tT@uDIUAuрHffffff.HH9s:yH9@AELAEAU$19L!IAAEtbu H s+ tK@u;IUAuрH fDHH9s:yH9@AELKAEAU$)DHILeD}HuLLdH %(H;Mu9H[A\A]A^A_]ÃAFAEAEFcfDUHAWAVAUATSHIIdH%(HEAFt]u H r+ tF@u6IVA6рHfHH9s:yH9u@AFL;AFA$AEtku H Ar+ tT@uDIUAuрHffffff.HH9s:yH9@AELAEAU$19LIAAEtbu H q+ tK@u;IUAuрH fDHH9s:yH9@AEL+AEAU$)DHILeD}HuLLdH %(H;Mu9H[A\A]A^A_]ÃAFAEAE&afDff.UHAWAVSH(IdH%(HEHDžHDžDžfDžHA6AVр΋Hр19FBADC1Ƀu/H5HcHI~HpZfff.I~HpODEtHHt-dH%(H;EuDH([A^A_]_HtHHtH!cUHAWAVATSIIHCt\u H Do+ tE@u6HS3рH@HH9s:yH9$@CHC1ɄuPH HcHAGMgtR@uNIWA7рHf.fffff.HH9s:yH9@A$H;MgA$ $<tgLLWAGrLt9tB@u0IWA7рHHH9s:yH9t;@AGLLML[A\A^A_]ÃCA$ڃAGUHAWAVAUATSH8IdH%(HEHDžHDžDžfDžHA?AwрϋHр19FB׿C1Ƀu=H Hc4H1IHpE1AMgI LL9LhHEuA<$ED)t)fEt#tffǀtU#fffff.tCTG_CfAƀt DUAGAGACH)uIII9h1ۅۋEÉtHHtodH%(H;EuH8[A\A]A^A_]'\HtHHt(H`_UHAVSH HdH%(HEHDžHDžDžfDžHsр8Hр9u51Ʉu*AH NHc4HH{HpU@E1H{HpZAtHHt:dH%(H;EuAH [A^]ZHtHHtH/^ffffff.UHAWAVAUATSH(HdH%(HEHDžHDžDžfDžHsр8Hр9u?1Ʉu4AH (Hc4HH{HpE1AIfE1LkILML9L`HE<$A}ED)t)fEt#tffǀtR#fffff.tCTG_CfAǀt DkRAFAFAC)HuIII9h1ۅAtHHt6dH%(H;EuAH([A\A]A^A_]XHtHHtH%\DUHAVSAHnHHH)ƋKH1yetffD9tNft wQG_CAfAƀt RQAƟAƍOB9[A^]ffffff.UHAVSII^AANрL4CfHL9s+;wGȉ fCW[A^]@UHSPHHtGf ft?HfDwAЍA fC fDWfCf HfuH[]@UHAVSII^AANрL4CfHL9s+;wGȉfCO[A^]@UHSPH1HtsGrbtFtX@u=HW7рHffffff.HH9s:yH9t@GH0HC GHGH[]fDUHSPH1HtsGrbt]tA@u=HW7рHffffff.HH9s:yH9t@GHHC GHGH[]fDUHAVSIH1HtGrat\t=@u9HW7рHff.HH9s:yH9t@GHPAHCG$AHG[A^]1HtXGrGtBtH@uDHW7рH HH9s:yH9uGHGÃ@GUHW茡fff.UHHt&)`)p)U)])e)m)u)}LXLPHHH@dH%(HEH0HEHEHEE0EHU(dH%(H;Eu H]Sff.UHAWAVAUATSHXIIIdH%(HEE,$A\$рDIGHEA)EI|$A4$AL$рLEHLc^xSLEEEHHEH}LE:H}'E,$A\$L+NӀAAD9DCAACLm@ۺ1L-1/IGHEA)EI|$A4$AL$рHLMy]yF1/8 1/8t1/8 y1r/8"iYLEEEHϾHEH}LEtH}Ht dH%(H;EuHX[A\A]A^A_]舟QHEtH} HEtH}Ht轃HTDUHHt&)`)p)U)])e)m)u)}LXLPHHH@dH%(HEH0HEHEHEE0EHU(dH%(H;Eu H]Pff.UHAWAVAUATSHXIIIdH%(HEA$AL$рIGHEA)EI|$A4$AL$рLEHL^xSLEEEHHEH}LE/H}L{A$AL$р9CЃCLmۺ1L-1,IGHEA)EI|$A4$AL$рHLM^yF1,8 1,8t1,8 y1r,8"iYLEEEHϻHEH}LEtH}Ht dH%(H;EuHX[A\A]A^A_]舜NHEtH} HEtH}Ht轀HQDUHHt&)`)p)U)])e)m)u)}LXLPHHH@dH%(HEH0HEHEHEE0EHU(dH%(H;Eu H]Mff.UHAWAVAUATSHXIIIdH%(HEA$AL$рIGHEA)EI|$A4$AL$рLEHL[xSL谿EEEHHEH}LE/H}LxA$AL$р9CЃCLmۺ1L-1)IGHEA)EI|$A4$AL$рHLM[yF1)8 1)8t1)8 y1r)8"iYL苾EEEHϸHEH}LEtH}Ht ~dH%(H;EuHX[A\A]A^A_]舙KHEtH} HEtH}Ht}HNDUHHt&)`)p)U)])e)m)u)}LXLPHHH@dH%(HEH0HEHEHEE0EHU(dH%(H;Eu H]Jff.UHSH8HdH%(HEHDžHDžDžfDžHHKoHHH1H&tHHt\|dH%(H;Eu H8[]JHtHHt!|HYMfUHHt&)`)p)U)])e)m)u)}LXLPHHH@dH%(HEH0HEHEHEE0EHU(dH%(H;Eu H]KIff.UHSH8HdH%(HEHDžHDžDžfDžHHmHHH1HtHHtzdH%(H;Eu H8[]~HHtHHtzHKfUHAWAVAUATSHMDdhHXlIdH%(HELm L}H]L{ID$HEHjHCHELZIGHELJIEHEH](H6HCHEH]0H"HCHEH]8HHCHEH]@HHCHEH]HHHCHEH]PHHCHEA6ANр1L腹DlD MFEANрAHEH$LXLDhD⋝d9ADLDtmAANр9HMsYINA ufAƻLHMDdhHXlHMDžxHDžp!H $LpE1DHpHt Džx1ۅt F ufFLݶxtHpDžxdH%(H;EuHĈ[A\A]A^A_]EHfH HHpu xu DžxHpDžxHHHfUHAWAVATSIHICuTAD$uGL{Md$LL谑Ís1L\tpI~LL[A\A^A_]HUL{LIMd$LLÍs1LtI~LL[A\A^A_]鶕[A\A^A_]ffff.DG1A@u>HwDрHffff.HH9s>yH9t A@DGAADGUH1Hu II HHwHtfHthIIHt1DfEfEtiIthHIIHufA]@DfEHfEt2IHIuJf]f 111@]Mu Htf 111"]fDwP]@UH1Hu II HxHtsHtfHtfIIHt5DDEEtcItbHIIHuA]f.DEHEt,IHIuD] 111X]MuHt 1113"]D7P]UHSPHStF@u6HC3рH@HH9s8yH9@SHlStWЃu HQ+t@@u0HC3рHfHH9s8yH9t;@SHS҃HHCH[]ÃSzSUHAVSHdH%(HEHEL5P+AHt HXxH]rsHHUHQ0tCH]HAHt HXxA7sHHHQ8D4J1H=Z+LY+ffff.^HcHHJ9H9WH9WH9H@HNd|H=Y+ffff.Hu 1HWtnH?u 1HtbH HFHHdH|̸Y+HHEHc HcHHBDdH%(H;EuH[A^]HHBD?f.UHAVSHdH%(HEHEL5O+AHt HXxH] qHHUHQ0H]tHtHAHtpHXxH1H xX+LUHSHdH%(HEHEHM+Ht H@xHE SpHHUHQ0HEtHuPEG1H*W+H5V+HcHH97t)H9Bt#H9BtH9tH@d|1ۃ=V+dH%(H;Eu H[]]=ffff.HYV+HD11ff.[Xff.OHV+Hf.HU+UHHdH%(HEHEH}jHEdH %(H;MuH]ptHxHtQtHHtQAHߛHCAExtHHtLQH@ZAu SAdH%(H;EuDHx[A\A]A^A_]IItHHt PIIptHxHt PIItHHt PIIA.IIA/IItHHtbPHVYEE1Au*L HE1r1IIL N1yHH uH@LLgy@"t#H Ch@A1+MMEIH@LЉMtL9_Hg8 y'H\>HMtL^HPg H6>HHV H>fffff.UHAWAVAUATSHxIAIdH%(HEHWH[*HHHWDžDžDžH'HH1蒕DžhDžlDžpHxHhLHDžHDžDžfDžHHHh/:ptHxHtMtHHtME1H HDL躮AEtHHtsMHgVEu {E1dH%(H;EuDHx[A\A]A^A_]IItHHt MIIptHxHt LIItHHt LIIE1+IIE1/IItHHtLHUEE1Au*LHE1-II!L-HHuH@LLcu@St#H td@A1\MMEIH@LЉMtLj[Hci*-H:HMtL-[Hc Hg:HHHO:ffffff.UHAWAVAUATSHxIdH%(HEHSH)X*HHHTDžDžDžH]HH1ȑDžhDžlDžpHxHhLDHDžHDžDžfDžHHHhe6ptHxHt JtHHtIE1HBHFAEtHHtIHREu E1dH%(H;EuDHx[A\A]A^A_]KIItHHt KIIIptHxHt )IIItHHt IIIE1+IIE1/IItHHtHHQEE1Au*L?HE1)II]L)HHuH@)"LL3`q@t#H `@A?1MMEIH@LЉMtLWH_*-H6HMtLiWH_ H6H[HH6ff.UHAWAVAUATSHAIHdH%(HEHxPHcT*HHxHxLPDžDžDžL%LH1Dž`DždDžhLpH`H~HDžHDžDžfDžHHH`2htHpHtEFtHHt+FDž`DždDžhLpH`1DžHDžLDžPLXHHL蔄HDžHDžDžfDžHH`HH1PtHXHt[EhtHpHtAEE1H蒏HHHHD͌AEtHHtDtHHtDHxMEu E1dH%(H;EuDHĘ[A\A]A^A_]hIItHHt hDIIPtHXHt FDIIhtHpHt$DE1IItHHt CIIhtHpHt CIItHHtCE1PIIE1EIIE1IIItHHt}CtHHtcCHxWLEE1Au*LHE1s$I ILO$z HHuH@L`LZl@#t#H D[@As1,MMEIH@LЉMtL:RH`Z9zH]1HMtLQH`QZ H71HHWH1ffffff.UHAWAVAUATSHAIHdH%(HEHxJHN*HHxHxJDžDžDžL%'|LH1蒈Dž`DždDžhLpH`HHDžHDžDžfDžHHH`/-htHpHt@tHHt@Dž`DždDžhLpH`1訇DžHDžLDžPLXHHL$HDžHDžDžfDžHH`HHE,PtHXHt?htHpHt?E1H"HHHHD}AEtHHtv?tHHt\?HxPHEu dE1dH%(H;EuDHĘ[A\A]A^A_] IItHHt >IIPtHXHt >IIhtHpHt>E1IItHHt >IIhtHpHt j>IItHHtH>E1PIIE1EIIE1IIItHHt >tHHt=HxFEE1Au*LcHE1I+I L9 HHuH@M F L`LWU"g@t#H U@A1MMEIH@LЉMtLLH`U  H+HMtLLH`T H+H H H+ffffff.UHAWAVAUATSHLHMAHPHXIdH%(HEH%EHnI*HHHWEDžDžDžHvHH1 DžhDžlDžpHxHhLzHDžHDžDžfDžHHHh'ptHxHtP;tHHt6;1H`MAtHvLEAD$III1HH`DF1LD {AAD$рDA9\$sLmAD$A$tAt$LmMD$LHXHPDLHADH`E9vMID$A $AD$uHfDD1H`1E1E1LHXHPHH`H`DAw1LzAD$рAE9|$sLDmAD$E<$tAt$LlMD$LHXHPH`LHHH`@AT$уA$IL$u fDD=tHHt9HBH`u1H`dH%(H;EuH`HĘ[A\A]A^A_]IItHHt 8IIptHxHt{8t;HHt/a8(IItHHt ?8II1H`3II1H`.IItHHt7H@E1Au*LlHE1 I4ILBHH(uH@VOLL`O+a@t#H O@A1MMEIH@LAMtLFH&OEDH%IMtLFHN H%ILH%DUHAWAVAUATSHxIIdH%(HEHM?HC*HHH?DžDžDžHpHH15}DžhDžlDžpHxHhLtHDžHDžDžfDžHHHh!ptHxHtx5tHHt^5AGIIIE1HEFHLE11LDWuAAGрDA9_sLOhAGAtAwL3hIwLDAEE9IGAAGu fDDH~HAt$1LtAGрAE9gsLDgAGE'tAwLgIwHDcAAFAWуAIOu fDDtHHt3H<Eu ۼE1dH%(H;EuDHx[A\A]A^A_]o|IItHHt m3IIptHxHt K3IItHHt )3IIE1+IIE1,IItHHt2H;E1Au*LdHE1I,IL: HH uH@NGLLXJ#\@t#H J@AH1MMEIH@LAMtLAHJE)D+H IMtLAHI H I}LH ffff.UHAWAVAUATSHxIIdH%(HEH=:H>*HHHo:DžDžDžHkHH1%xDžhDžlDžpHxHhLoHDžHDžDžfDžHHHhptHxHth0tHHtN0AGIIIE1HEFHzLE11LDGpAAGрDA9_sL?cAGAtAwL#cIwLDtAEE9IGAAGu fDDHyHAt$1LoAGрAE9gsLDbAGE'tAwLbIwHDAAFAWуAIOu fDDtHHt.H7Eu ˷E1dH%(H;EuDHx[A\A]A^A_]_|IItHHt ].IIptHxHt ;.IItHHt .IIE1+IIE1,IItHHt-H6E1Au*LTHE1IIrL*HHuH@>7LLHEW@t#H E@A1MMEIH@LAMtL+E1HuHLKAE%tHHt*H3Eu E1dH%(H;EuDHx[A\A]A^A_]IItHHt *IIptHxHt s*IItHHt Q*IIE1+IIE1/IItHHt*H 3EE1Au*LHE1) IQIL_ 0HHEuH@slLL}AHS@t#H A@A1MMEIH@LЉMtL8HDA*0-HHMtL8HA HHH HDUHAWAVAUATSHxIdH%(HEHp1H5*HHH1DžDžDžHbHH1XoDžhDžlDžpHxHhLfHDžHDžDžfDžHHHhptHxHt'tHHt'E1HqHQAEktHHt?'H30Eu GE1dH%(H;EuDHx[A\A]A^A_]IItHHt &IIptHxHt &IItHHt &IIE1+IIE1/IItHHt_&HS/EE1Au*LHE1oIILKvHHuH@LL=O@t#H @>@A1(MMEIH@LЉMtL65H=5*v-HYHMtL4HM= H3HHSHff.UHAWAVAUATSHHIH}dH%(HEH}-H1*HHEH}-AEIIIE1HEF1LDdAAEрDA9]sLWAEA]tAuLWIuH}DAƐEE9IEAMAEufDfff.DCt$1L'dG<$AEрDA9]sLWAEA]tAuLWIuH}DqAY蔬AAFAUуAEIMu fDDH}K,Eu D^E1dH%(H;EuDHH[A\A]A^A_]HIE1HIE1HIEHIH}+EE1u*LbHE1I*IL8 HHuH@LEH]HY:$L@t#H :@A"1MIEHH@HЉMtL1H}#:HHMtL1H}9 HHHHUHAWAVAUATSHHIωUHuIdH%(HEH}L*H.*HHEH}*E11L}aAGрA9_sLvTAGAtAwLZTMwE1LHuULAEELYAWуAIOu fDDH})Eu 誩E1dH%(H;EuDHH[A\A]A^A_]AHIE1HIE1E HIƉE ]HIH}+)EE1u*LHE1HIpIL~$OHHduH@H]H7jI@t#H 8@AV1MIEHH@HЉMtL/H}i7t Y]H4HMtL.H}+7 HHH1H fUHAWAVAUATSH8IdH%(HEH}'H+*HHEH}'E11L^AD$рA9\$sLQAD$A$tAt$LQIt$AE5ADAT$уA$IL$u fDDH}&Eu DE1dH%(H;EuDH8[A\A]A^A_]HIE1HIE1HIH}&EE1u*L HE1II)LHHuH@H]H5F@^t#H 5@A1gMIEHH@HЉMtLu,H}4w踥H HMtL;,H}4 Hx H0HH` UHAWAVAUATSH8IdH%(HEH}%HO)*HHEH}>%E11L7\AD$рA9\$sL.OAD$A$tAt$LOIt$KAE襤ADAT$уA$IL$u fDDH}Y$Eu DlE1dH%(H;EuDH8[A\A]A^A_]HIE1HIE1HIH}#EE1u*L{HE1ICILQ"HH7uH@e^H]Hr2=D@θt#H 2@A1׸MIEHH@HЉMtL)H}<2(H HMtL)H}2 HHHHUHAWAVAUATSH8IIdH%(HEH}s"H&*HHEH}"AEIIIE1HEF1LDYAAEрDA9]sLLAEA]tAuLeLIuLDfDAE9IEAMAEufDfff.DAv1LXAEрDA9]sLKAEA]tAuLKIuLDWE_ZAAFAUуAEIMu fDDH}!Eu D$E1dH%(H;EuDH8[A\A]A^A_]HIE1HIE1HIH} E1u*L4HE1IIRL HHuH@H]H+/@@臵t#H /@A1萵MIEHH@HЉMtL&H}.HHMtLd&H}. HHYHHfUHAWAVSHIdH%(HEE1{VAGрA9_sLtIAGAtAwLXIIHukAWуAIOu fDDDuAv1LUAGрAE9wsLDHAGE7tAwLHIHuүUAwAIOu fDDdH %(H;Mu H[A^A_]fD1ffff.1ffff.1ffff.UHSH(HdH%(HECtHuH^CtsHGCЃHKHMEHu\HBquZCtH辝uH^CtsHGCЃHKHMЉEHuк/HpdH%(H;Eu H([]@\/f.@UHAWAVATSH IIIdH%(HEAD$t)u H*tLuL]A$AL$рAFt)u H*tL褜uL]AANр؍tA9ws LaFLLELHEȉUHu1LLidH%(H;Eu H [A\A^A_]D=*E D=*tUH ]t }*fff.UHAWAVSPHII@HtmHH5%&Lt7H5&Lt$H5)L@uL3IFHILP1H[A^A_]ff.UHAWAVSPIIH@MtqHIH5%LTt7H5y%Lfffff.UHAVSH0IdH%(HEHDžHDžDžfDžH*H@HЉÅxHLtHHtdH%(H;EuH0[A^]FHtHHtIH聾UHAWAVSPIIHCCH'HCHLHQ7K LHx H[A^A_]ÉICtH{HtHkLUHAWAVSPIA>tC1ff.L&L8MtAGtIHtYLA;rLH[A^A_]H?HLH,f.fUHg]H f.UHSPHHHHffff.QHzrft@1E1E1Hjj*H t-ɉ v7H)H?&H 1lt@t  NH[]ffff.UHAVSHH@tyHLJH9vOfff.ZXZXZXZXZ XZ XZXHHH9rHE1@HHH9rHE11IAjj Hu sA@tDADND[A^]ffff.UHSPHHHHffff.QHzrt81E1E1H t*ɉ v4H)H# 1r@t  NH[]f.UHAVSHHAfBH@uJt HH9vL9f8yfxyfxyfxyfxyfx yfx yfxHHH9rHH9 J4 I)IIMIH9s JHH9IxIIAZ1HrgH{L)1f~f`fqP~Df`fqDP~Df`fqDP ~Df`fqDP0H HuHt-H<HPH@~f`fqHHHuE1M9taJ@LHfHH9uE1@E11IAu pA@tDADND[A^]ÐUHAWAVATSIII_ff.CHHrft<1E1E1LjjHÅtc˸wqE1L)H?[HA{H52 HIHt6ALHʉ[A\A^A_]o@t  N[A\A^A_]f.UHAWAVATSIII_ff.CHÍHrt41E1E1LsÅtc˸wqE1L)H[A{HH5L HIHt6ALHʉ[A\A^A_]zo@t  N[A\A^A_]@UHAWAVSPIIMt LNHMt L<؉MtMtAftfA>H[A^A_]UHAWAVSPIIMt L^HMt LL؉MtMtAtA>H[A^A_]UHSPH.H1HtH9tHAQ.HEH[]UHSPH.ݮH1HtH9t HAy.HEH[]ff.UHSPH.M1Ht"H9tH.u1Ht fHHHH[]f.UHSPH.M1HtH9tx.u1Ht HHHH[]ÐUHAWAVSPIIH.1Ht"H9tH.u1Ht fHHHHHDHDIIH[A^A_]ff.UHAWAVSPIIH.蓭1HtH9tx.u1Ht HHHHHDHDIIH[A^A_]fUHAWAVAUATSH(LEHHUHuI.E1HtL9tLxH.LEMM)IMMDAH}HMtEtAAH]HcL9ICHcHuLmLLHxlfAD]H]L;eEAHt^HEЅtVHEЍ@MIOIHcLELLcL9ICHEHcHuLLHlfA_1L;eABDH([A\A]A^A_]fff.UHAWAVAUATSH(LEHHUHuI.E1HtL9t Lxx.LEMM)MMDAH}HMtCt?AH]HcL9ICHcHuLmLLH>lADH]L;eEAHt\HEЅtTHEЍ@MIOIHcLELEt4IELf9t8HHHufA$ 111I 111AH91f:fEt>LH1fff.A|t4HHHuAE 111I 111BILL)1H52tH<HHuCDAMtJAAt=Et(IcHH1DA| t2HHHuAE 111DH[A\A]A^A_]AT tIT H)HHtA62HƄuADE1fff.UHAWAVSPIAHHt\E~WfHt=:t8A|BEO1It&HHcfK.HcHKA)MtEu A>t1#1LIEn1ɅH[A^A_]f.UHAWAVATSIIIMtL*HÃMt L؉HcLHtHljLL[A\A^A_]1[A\A^A_]UHAWAVAUATSHHIH}AMtL貤IAHH]tH蚤DAMcHL!E1L9K46H} HEHMftaA<$tZA|xEOE11LI!tVHHcfK.HcHKA)HEHtEuE18Au$1HUIEE1ADH[A\A]A^A_]DUHAWAVATSIIIMtLHÃMt L؉HcHLHtHljLL[A\A^A_]X1[A\A^A_]ffff.UHAWAVAUATSH(IHIdH%(HEKрMotgAAOрu LHq GL%3LPDEELeEHULHEtH}HtAAMрt LHEUHu1LL0dH%(H;EuH([A\A]A^A_]HEtH}HtHSUHAWAVAUATSPEMẢI1=fAHtkftcKD9DNMcMtVLcIuUfAfL)IvHfffff.HtbfHHHfutE1rfAgfAft^IxIA1H9tH9t'LrfALvHfu2II9ufCDF fADvfA 111D)MfA}0DfAF,AD$fAF كAD9DNMcMMu MHcHtYLcHuXLHLA}f>fHIHultIcfAFAIcfAFfAcHھL)LAMfftHHtIHHHuf,Hu fCDAfA 111ADDD9HfAFg1H[A\A]A^A_]ffff.UHAWAVAUATSPIIH}E1Mt LHMt LIFl#IcHH}HtHDLME1H[A\A]A^A_]fff.UHAWAVATSIIILHLٞ\HcLjHtHljLL[A\A^A_] 1[A\A^A_]fUHAWAVAUATSHI׉IE1HMALlK9HEOHcLcLLL `LuC.+AAE)tZ1HM9EH}!IAGD9AOIcLeLMcHcLHUH_DHcAE1E9DLeDH[A\A]A^A_]fff.UHAWAVSHIIHdH%(HEhH@HEЉUHu1HL(++HKHHEЉUHu1HL*dH%(H;Eu H[A^A_] f.fUHSH8HdH%(HEHEEHEEEfEH}HHEUHuHM1Hj*EtH}HtdH%(H;EuH8[]kHEtH}HtrH誤f.UHAWAVSPIHL9ss.Iw.H;Ht 4HLsHCE1?LsL;6H5 LIH;Mt5Ht HL;LsLsHMIEHH[A^A_]HtWHC1UHAVSII~Htffff.HxHHuIFA[A^]fff.GH9wD)H?G9sHDfff.UHAWAVAUATSPIID$A$El$D9sXHuIƐIHu1G|-J<H5OHt4HDxID)DhD9IsA $HuЉHtA $1ɉH[A\A]A^A_]SH_AD+KrHHAuYHtOD)DA)EDSE)ECE9sDffff.H9TtHD9rDHE1Hu[ff.HOQWH 19s!LAp)r)O WwIHf.AVSD6A1AA~I~ffff.D7Et[@A^Ѓ6wiIr#Ir-IsW %fff. HDAutt u  f 1[A^fff.UHAVSIHΘH&;{{ -{-{-{-u{%}kI~~s1NЃ6BI8HcH4@{tAOЃ6Hr1~Hr.H~H ƟQ  ƿs0NЃ6Hr*~Hr'H~H Ÿ  ¿sNЃ6JHr*~Hr'H~H  Ÿ  ¿spNЃ6Hr*~Hr'H~H Ÿ  ¿sNЃ6Hr*~Hr'H~H` Ÿ  ¿sNЃ6*Hr*~Hr'H~H Ÿ  ¿stTNЃ6Hr*~Hr'H~H Ÿ  ¿AS HBЃ6kIaHcH 1@s tAFЃ6<Hr1~Hr.H~H Ÿ  ¿S JЃ6Hr*~Hr'H~H   S tTJЃ6wHr*~Hr'H~HM   fAFs1HNЃ6 IHcHU0@{tAOЃ6Hr1~Hr.H~H Ɵ  ƿsNЃ6sHr*~Hr'H~HI Ÿ  ¿stTNЃ6Hr*~Hr'H~H Ÿ  ¿fAVSBЃ6IHcH .@CtTHЃ6Hr*~Hr'H~HY Ÿ  ¿‰AFC1ɅHЃ6IHcHe.@StAJЃ6Hr.~Hr+H~H   AN 1H5-AA~I~DSt[HЃ6weIs_Hc@LSt8yЃ6wDIrIrIs2   ȉAL H1H|@[A^]@UHAWAVATSH0MIIdH%(HEEEHEHEH,HMLE)H}tEH}HtEx*HH@1LLЉÅxEMtHEI}tH}Ht HH@E}tH}]EdH%(H;EuH0[A\A^A_]HHHHH}tEH}u}u EH}Ht HH@E}tH}ϯEHH訵H蠵UHAWAVAUATSH(MHIIIdH%(HEMtIMtLӿADD\1MHDžHDžDžfDž@fA<$uw11LGgIMt3H5+LpHt&LLHЉÅx-Mt5M'0NN@t؁NMtL茮tHHtRdH%(H;EuH([A\A]A^A_] H2HMtL0 HHtHHtH!ffffff.ffffff.1ffff.ЉH@1H։ʉeDUHAWAVAUATSH8LAAIIdH%(HEЋ*uH}aMȅɸE*H9v"uH}aMȅɸEִ*ILLDDdH %(H;MuHDHH!HH8[A\A]A^A_]译ffffff.UHH@dH%(HEe*uH}aMɸEE*dH %(H;MuH@]Kff.UHAWAVAUATSHXDEMIHdH%(HE*E1HHEHHL=*It HuH}Hl`HHEIH9vHHuH}L`HMIML5*It HuH}H%`HHEIL9sHIuH}H`HLmM.E1I9)IHuH}H_HHEIH9u'IHuH}H_HHEII9HMHLHUHMIMHH%E1HMH E1L9ADHfAϺ0HHu,HtrHE}u H;Es3Ht.HHEH9HFHEHAOE1L9Av2 HHuM=IHM[&AE1_tYD*HEAEMH'Lr[LEHH 9'ATASARAUuw_H0MH]L9v-"_tH Z'114_E1EtI^E1t3H O'E111^1HuUM&IdH%(H;EuLHX[A\A]A^A_]HE1fHy*H@Hq*H@UHAVSHdH%(HEEH=J)5?E1UPHHtsH5&H^HH*HHtRH}хtHEtAH5&H,H ݯ*HHt#H5&HH *HE1HAdH%(H;Eu DH[A^] f.H*fDUHH p*]fff.Ha*H@HY*H@HQ*H@HQ*H@UHAVS4OHE1Ht}H5%H:H *HHt_H5%HH *HHtAH5%HH Ϯ*HHt#H5%HH *HE1HAD[A^]@t1҉uÅtfD1҉u1҉f.UHAWAVAUATSHdH%(HEEH *E1HU̿1tFz}H5|IMHU̿LE̅Mt11MfIUtH M,9‰rAE H *fL%*A$HH<@H5fIH*LMfA<$1L `*fDH@HHA|!fAHcHHHN趰IW)HDžHHk,ELMLHHDMcLL"MC4tLPHDžLf LLA Ƀ uv ͯH@HHHHPDpH@ILx1 )u*fA)fff.fDkHD Ƀ uH!HADD1Ƀ,AθDLIM)It DžHADHcHHHN'IW)HDžHL*HALMLHHDMcLL萁MC>LtIL踯LHDžLDHCK:HDLc@HfEdH%(H;EuHX[A\A]A^A_],}HHHt6HDžHcIH?t(MtEAHy<$zI ILMtLBHDžLo}ffffff.UHAVSHHt"H;LsHtH跫MLu[A^]f.UHAVSIHHt*fffff.H;Let H[Hu1[A^]ffff.UHAVSHHt0H{HtrH;HteLsHMLu[A^]fff.UHAWAVAUATSHMIL7MMHuAFt ;EM&MH]tbLHxtS:HwIMA}:LHLxulI~AH HuA)L@I^AHHLexHest!Ȁ<*uHLHqMvM#fffff.AFt;EurM>AMtwLH]Hwtd:HvIMt?A}:u8LHLwu%I~Ht,HuA)L=qtfMvMsE1DH[A\A]A^A_]fffff.UHAWAVAUATSHDEII}AAL=qLuHUAvMAIzI>DFEF@*HtHA AuEF=E0HI>AEF@uDǃ1A uEf.D%=u%>AA?AGA ĹLA>DAAGD O DgA ̹DHA)MI>EFtdAH [D $DAIELDEEPEHULuEL=1A˸?91EN7@sAE$}E1AA}LLAE][A}LL~AE8IEF 8BEA}LLL1AEIA~D:EAH@EHwI6AEFȃ 9`@D>EAES`AuOP%=uAAs 0AAr%uHI>A)EFDH[A\A]A^A_]É%=BArԃ?B D%=HArA?ABA ǾD%=AAcA?AGA ǹ;AB;΁'B r J HIA)EF:@OCEH4I6A)EFD EtDEuQD%=uDAs-oAD`AAGωH IA)EFD EHtuA DAABD r DzA HI)A~AA1A}LHAEy%=.CAq?B ǹAALD7AAGD O DA ϹHI6A)EF1E1LLLAEAHA1ALHAEyHtEED%=usEAkA?AAA ACC/B J z Ϲ9AEDʁAAAD Q DIA ѺHIA)AɉHIA)EFExFEux%=uFAsUAFFt.DUHAWAVAUATSH(LEAdH%(HEEHuUȸ7HHHuʉUȉ߃D%E1= >=}=߃ t :-; uJ}= t;=A}ty} 9ك`@AuZ9ـt:t5t9Hu1ADHM-@Atp>@x<uLe%=u<s*C<5HHu)ʉUD.Ex<D%=u$<A?AFA ŹK<DAAFD N DnA ͹HHu)ʉUE9sHLeH]fDE1EADLHHMx,AE9r؋M}t uGȉdH %(H;MuH([A\A]A^A_]jUHAVSIML%I^HtvHDHrH5H蚖t(H5Hǖt*H5H贖u*CH.u 0uH56L[A^][A^]H5HH-ff.UHAWAVSPIH;BSJBKftrɃuf{tcL{M>LdHrH5LIctAH5LitH5Li1u HhI1H[A^A_]À{.H{u 1?0uH5Lb1uH %Ifff.UHAWAVAUATSPIIWx;IGHLcE1L)LCr IwIIOHHDN`I9sH[A\A]A^A_]HME11L謙u 1E1E1L莙AHcHH!H9uHL10ÅA AuPIGHE1L)LCrDIw;IHHMHENaI9ȸ?1L$LHOHHII!IHH HHHH+H$HL!L H H H H DHHII!HIIA HHHH+H$HH!L L H H H ff.UHSPHofHHHH!HH%H+H HHHH HH% HH HHH$H HH(%H HHfHnfHnflf(HHH[]ݗffff.Ht(HWt:1uRHH %1H;C6HH1H)C  H7 %1D Ðt!t61uOHH %1H;HH%1H)C  H7 ǁ1D ff.UHSPHt>tgHH#CсH#H H H HStHH#сHHH H HFof%HсH H H7fHnfHnflf<&HHH[]fDHHWHHHH!HH HH!H H fHHHH!HH HH!H H fUHSPHI?L#HH#KHHHHHHH!HH(H HH H L HH Hs*%HHH[]@O %B GW %4F  fffff.%DGA  ʉ%p@ D ffOAAODGA% pA D fGfOfffff. w 11% 5DDDGAAAAAAD1ЃD1҃ AA E  D (fDfWf% ff. %D# Ɖ7ff.# # Ɖ7ÐUHAWAVAUATSHIIA荌H HHHHHHcH5P1HHArAA6HfL"u1@f"DfHft$L~uʃ t ufCHDfHEJLuE1I(BHffff.OH t tfJHEMԉHMHf.HHH1HG\t"u)HwAu7Et$"uH%HAH1EE1A‰…DjIMHsHf.IM!IM!LHL!HIIAyH8ArPLGM)E1ffff.BsBDsBDs BDs0BDs@BDsPBDs`BDspI@IuHtJsHff.HHuL9It"D)J c Hff\HIuJ\kft6Eu1 t* t%EYf HMffff.DfHfAҋUHMHHH[A\A]A^A_]UHH`dH%(HEH(H1Ht HY*dH %(H;Mu H`]g]1ffff.UHAVSAH=)1t7Aut*A&A?!w.HHs[A^]AtAtA)t@1111ffff.UHAWAVATSH@IdH%(HEI$H}耗Hɛ)HHEH}踗Z*ucH=)11n ÍC=w/HXIH=LD t1L5*u *~*LH}1H~*I$dH%(H;EuH@[A\A^A_][HIH}іHIE1u*LI^HE1nIUIg]L^nTHH^uH@3],]L}L@ @+t#H @A 1+MMEIH@LЉMtL賜H} \H{HMtL耜H}פ H{Hu\H]H{DUHAWAVATSH@IdH%(HEAWMfA<$A"}*H}Hb)HHEH}QL詅HL{LHHHCIMtFHLfffff.A $fft5HIHufA 111p 111^E11L5p|*tL膋AQ|*H}pdH%(H;EuDH@[A\A^A_],Y HIHIH}1E1u*L[HE1QlIyRIZL[-lXRHHm[uH@ZZH]H訢s@)t#H %@A 1 )MIEHH@HAMtLH}qZHOyHMtLH}F H,yHYHL[Hy@UHdt]襤DUHAWAVAUATSHHIHdH%(HEH荒H֖)HHH迒HDžHDžDžfDžHHKdHHE1HH謂IMl$LHHHCH5wIMMt6IL fft5HHIufA 111r 111`M>tHHt胈Hw1dH%(H;Eu5HH[A\A]A^A_]]@tN VǣHI(HI,HItHHtHE1u*LkXHE1 iI3OIWLAXhOHH'XuH@UWNWHH_*@%t#H ܟ@A 1%MIEHH@HЉMtLҖH&VHvHMtL褖H HuHVHWHufDUHAWAVAUATSHHUIIdH%(HEI|$11130AEAv1LAGрDA9_sL菹AGAtAwLsMoHEL_I|$HMDL/tH}tD9sHML)HHU HD9BAwAIOu fDDD9s*dH%(H;Eu%H[A\A]A^A_]&7SUHW@tȁNȉ]f.fUHAWAVATSHIHdH%(HEHuHULD}AL9{s.Aw.H;Ht ÄHL{HCE13L{L#*L蚃IH;Ht 芄HL#L{L{HMIE܋MuLH+xdH%(H;EuH[A\A^A_]ÉRf.DUHAWAVATSH IdH%(HEIvuHH HH"AAA AHH!Ӄ uII>HUDAA}I>AD Ht f8AN Hft*LMI>HuAЅxbHEHtY16.H}Hu1wE1.8"uHEHEH;EtE f8u AFEԅtAZAN tEI>AvHUDAA}u/I>ADHtf8u E1A~AdH%(H;EuDH [A\A^A_]FPfDfffff.UHAWAVAUATSH(IAIdH%(HEAL$ AAA AӃ uILuI<$At$HUDADEt DuE;t$AL$ LuAuwHr*LMthI<$HuAЅxFHEHt=L1c,H}Hu1>uA1D,8"toHEH;EtehAL$ uI=LuI<$At$IHUDAEt xDuDuE;4$uLuAE4$HEEt$dH%(H;EuDH([A\A]A^A_]NfUHHdH%(HEHU1@dH %(H;MuH]FNfDUHHdH%(HEHEHu*HEdH %(H;MuH]Mfff.UHAWAVAUATSHHuIdH%(HEAOAAA AӃ u"I?DIMAOHp*HHI?HuЅH}Ht}xHLcLHHHCH5M~IMMt1HEHt"HL@fftLHHHufA 111袎'E1AG tRI?DIE1Mt5AG t+HEHuLNxLeMt L~MHEL 1dH %(H;MuH[A\A]A^A_]ø1LUHAWAVSHIIdH%(HEIwHÉٸH9ux]LuH}Hu&}L9ut1u S1tMH9tHHH5T}IƸMt*M܍qHULtL}@M71dH %(H;Mu H[A^A_]^KHLs}HNff.UHAVSHHdH%(HEHEH.n*HHt0Hu11HЅxHEHtdH%(H;EuxhAH1Ht H|*E11H HtH|AdH%(H;Eu DH[A^]hJHtv|DHam*H8DWG GHG0ufGHHwGf$< @FGHHFHs H9r UHAWAVAUATSHMHA1EMЉ}MMtAEHLlA)IW1f.zuD)4zu rD)tHH0A9uՅtH @HUȃ<u @LD) EH[A\A]A^A_]@UHAWAVAUATSHIIdH%(HEA@MAAU@uуAAw9Affffff.D9CT%I@uуAr܀1ҀH5HcHD9vsDATy.ׁtDAw"D)v#]DIHuLxDeE'AdH%(H;E DH[A\A]A^A_]ÉD)vԉEDLHuxDeA9sDAL@΁?AT ѾD9jDALy.ʁtDD9A| A@ u?AL  AAT  At  A|  A΁At A| AL ANA9KDEL5EDɁA?AAL5A ɺA1AĉD)}ȉEDLHuDẽ}1ɉD)MĉEDLHuqDe̋M;MrAxDɁAAAL5D AT5 EL5A ѺD9EtYA AɉAL y*ρtAD9EuACL%ysʁu&?CT% ѺNAA9D븉ʁCT% Ct% CL% AA3A90DATy-ׁtuA~@HUy]%=u?F ǹ<%W=F N ~ Ϲ@HMtF y1ʁtWOHMAF,>E1E}x E1EgED%=uA?Fl>E=D%W=Ft>BD>Fl>AADeĹAHMAϋED)EJ<>HuHu HuÅDDuAAA D eE1A ĿtiEE1D>$dH%(H;EuH[A\A]A^A_]D1@UHAWAVAUATSHIdH%(HEtUHHtF1$HuȺHmXI1D LmHbI9MDA"MEdH%(H;EuLH[A\A]A^A_]0ffffff.UH1t$@H1Htf9tH]Hb1]ffffff.HtfbDUHAWAVAUATSHAAdH%(HEоHHtH1# HuȺHUA1 ELmHaI9ED}"EEEEDdH%(H;EuDH[A\A]A^A_]/DUHAWAVATSIAGt)u H?*tLuLѫA?A_рHY`It)u H>*tLuL舫E'A_LyӀAEtJIGHtSDHL0f2ftMHHHufA 111p( 111ppfA 111XpL[A\A^A_]HL`H1ffffff.tbf.AA w0 f.7f FAJA s A0@A7fDFu1UHAWAVSHdH%(HEH}Hu1'AAII0II f{AAAAAA fnfnfbfnljfnfAnfbfofbfbfAnfAnfbfbf fo foffo ffffo fffnfbfbfofofffo5fffffffffrfrfrfrfkRfB-AHH$AJ7AZ0A fBfJHH(DP0X7 fABfZHH,DQ0Y7 fABfZH7X0 fBfJfB-AHH4AI7AY0A fBfJ$HH8DH0X7 fABfZ"HEމy7Y0 fBN70=fzDfBfJBE߉y7Y0 fBN70=fzHfBfJFfBJ}fBL'dH %(H;Mu H[A^A_])ffffff.1taAE11fF ^EQAƒ v7AAwA"fff.EQ@A҃wAEDIM9r1@1&>{2E11@FDVEHA v7A@wA"ff.EH1AɃAEDIIr1N-Nʃ҃ wDA$Q҃wDAQ҃DANʃ҃ sDI$Q҃sDIQ҃MDIVуɃ sDR$JɃsDRJɃDRAENʃ҃ sI"Q҃sIQ҃IAEADfON-Nʃ҃ wDA$Q҃wDAQ҃yDAN ʃ҃ sDI$Q҃sDIQ҃>DIV"уɃ sDR$JɃsDRJɃDRAEN$ʃ҃ sI"Q҃sIQ҃IAEADfON&-DF(AHу v)AHɃwAAHɃnADDF*EHAу r)AP҃sAAP҃3AEDɈODF,AHу r)AHɃsAAHɃADDF.EHAу r)AP҃sAAP҃AEDɈO N0-E1FD2APƒ v'A@wAAP1҃wcADFD4A@ȃ r'A@sAAH1Ƀw*ADBT IIwNJ1}fDUHSPHHCH[]fUHAWAVAUATSPIIAM/C1ɅtIMdEA}FtIuA<$Ft Iu1M/AH[A\A]A^A_]ffffff.UHAVSH@IHdH%(HEH}EMHT HH!ITHHH!HH9dH %(H;Mu H@[A^]#fHt&Ht UH]1@Ht&Ht UH]1@ff.HHDOffffff.HHD/ffffff."f.UHSPHw(sHcHH!HH[]UHSPc$_H[]fff.K"ff.UHH@dH%(HE)EG)EЋG EH}dH %(H;MuH@]"UHw%)]&ff.!ff.+ff.UHHdH%(HE]EdH %(H;MuH]!f.UHHdH%(HE}UdH%(H;EuH]!f.UHSPH%HH[]u(wHGw(wHGuG=w'GËuAtt(wHGfffff.UHSHHt))P)`)p)])e)m)u)}LHL@H8H0H(dH%(HEH HEHEHEE0E1LHUHH)dH %(H;Mu H[]O ffffff.UHAVSIH1HHL[A^])f.UHHt&)`)p)U)])e)m)u)}LXLPHHH@dH%(HEH0HEHEHEE0EHU)dH %(H;Mu H]kff.UHSHHt))P)`)p)])e)m)u)}LHL@H8H0H(dH%(HEH HEHEHEE0E1蜐HUHH}1dH %(H;Mu H[]ffffff.UHHt&)`)p)U)])e)m)u)}LXLPHHH@dH%(HEH0HEHEHEE0EHU0dH %(H;Mu H]ff.UHAWAVAUATSH8HIHdH%(HEE'1E HMHHH9H9 AHDžI݋tWAIfff.A}IuEgIEu fffff.A]fff.\ At-IA]IpuEgI1Eu" A%) AMthHEHH9v`I_ƅ%HHxIMtKA<*uIBƅ*AGIE1H+E1zT IHȃA E1J 3C2HH9HEH9C7CD7Iƃ rDC21 MLIMELADMA AfA9E/ HIIEufEM} AE6u9AEIM4LDDII IA}AHGXH CHcHCAhI7IMĉ MAIƸ'HxcǃsW\ALþLH2Kzg}AlIHA[AE^AF^IfAEInu AhIAEIAIƸ?tǃcu AlIƾAcIIDAEIAIƸHE1fA%nAFLEڃHupAwhH EDKwCwftxLc u`M9}[IIcIOAOfuEIBHLH+Hu/HcH(w=HHNR;E􃽼IHcH(w"HHNR HNHQHVH fHNHQHVH HE uAMcKwCwfuvAlIƸAsIIHE1kIIȃ]uA]IfAEI-u+A- II/IIA-AFIIAEE1-u,AE]u IA-IAMf9vAF뷹Hfȃ]tAA]w11E1E1Ljj;HÅHcOIM11LMAjj{;HHHpr\)֍AHHcɈ yHc=AH=Hc=utHcIHc5uƅ%ƅ*Dž1LHHHcHHHcH(gHHNRbHHc H(wHHBI HBHHHJHEA|$HOHIHI!оITH9sHTxI9׾HHH!HIIAqHr=HVL)1AxADDxAD Dx AD0Dx0H HuHtHxI<HHHHuL9LAL$)D)׃rbA)AwfpATwfTpATwfTpATwfTpATwfTpATw fTp ATw fTp ATwfTpHA9utHpI4w>f:HHuHufBp-1LHHHHc H(wHHBI HBHHHJHHTHHȅLHQHNHQHVH IIIGH9sHAI9׾IxHHrH0riH^H)1AALyLyAD AL0Dy Ly0AD@ALPDy@LyPAD`ALpDy`LypH@HuHt(H\yI|HGC H H HuL9LtAwfqHH9|fALklHɸNH0Ht1LHHL1LHHHL~wHcIGEufEdH %(H;MuRH8[A\A]A^A_]Ë׿臿L뷋Lq@UHHt&)`)p)U)])e)m)u)}LXLPHHH@dH%(HEH0HEHEHEE0EHU8dH %(H;Mu H]kf.UHAWAVAUATSHIIIH]HEAAAIEE1H8%LELMHHIMAI}Hx]HH IH (H5uLEHHIMAIIEH0w8Hs2ɃwHc HAAAAAAփuAуЃ LIEHHIMADIEȃHà rDE11 IHMȉ%M|IELH]LEy2*udHuHHIMAIIEʃЃ w9ʃЃ w&@HHIMAIIEʃЃ rހ. HHIMMwAIEʃЃ wy1ې IEHHIMAIEȃHà rE11 H}HMЉxIIEMH}H]LE%O*u^HUHHIMAGIIEЃ w@Ѓ w/HHIMAIIEЃ r HMMpu Aɀ.HHc4HHHHHIMXڀsu AlHuSAH#H3t!6u(x4u"HAHIEx2uHHIEAH€½Ҁ5H5*HcHAtptwuyAhpHAIEoA9CAA9SAfAllIAlIIEHHIMAIE1HHI;HcH(iHHIcHHHHxAu)HcH(Ltw>HHI;HcH(Ltw:HHI7HHHHHfD HHHHHHD Hu/Au)HcH({HHIuHH()I}HLAƋ|xHEoHpLt9HHHHHpLtƅ|LL%AHHHHHLtHHHHDH|)LHEYAHLhHpmHHHHHpLtHI}1H5HHHHHpLtI}1HAADDEHLhL AdH%(H;EuDHĈ[A\A]A^A_]Lfff.UHAWAVSPIIHH6+8HuHLLH[A^A_] ffff.UHAWAVAUATSHHXdH%(HEHHAH)LlLDžh fLMH%xHLH|LxLtATHpPuHHptulكu l|HH()HLLLLADxtDpHD払`AArwAMcLIMHH()HLLHL DpHD拕`mMLl11E1E1LÅHcHGIM11LMAHcHXHLM MtLwLof.u u=xHcH(HHRu.u)HcH(HHIHcH(HHIHHQH xtHcH(HHRHHHHD0Iξ1LLL`=AHcHIM0A1LHHHHQH tHcu(w/HHI,(w8HHI5HHHHHhfHHHHHhDxA"AZHcH(HHvfAHHGHHXHh0HHHHD01LLLD=AHcHIM1LHHDMHxB((w)&HHrHD:DxHAtt'u8HcH(w3HHR0(w/,)HH~H6t HHPtt(w6HcH3(HcHHHHHL0MAtm11E1E1LAEDH2HH11LIEIHHHHL(1H`EMHLDLILH HHHHIMHPu fA1>~,D9}'H BHcLIHLLtTLLDA)̋|HXLDu"hLH`LlHtu(w#(wHcHHHHAHffDžʋ|HXHt:hdULMtL 1DžhdH%(H;EuGhHĈ[A\A]A^A_]H`~LvH`]VfDff.UHAWAVAUATSH(AΉH}IH1҅IHHMHUDALcKMfff.L;L{uHHf.HAփr+tftr rҍR҃!wHrE1HfWLmLuIMI)IEuL谬IMt^11HDMEjjHt@HEDAHuLkL9eLmMEWf.MEMJLuE1LuLmfWEMtM.LEdH%(H;EuH([A\A]A^A_]fffff.UHHdH%(HEHuB1t EdH %(H;MuH]FfDr= r/G r$%rǿǃøffffff. ff.D1fEt`DfEt@H1HDfffff.fA9t6 HfuHDOHfEu1f|GH@uHt HHЏf.UHSPHHt+H=۫14{HtH)H0HH[]H[]UHAWAVSPHH11E1E1HjjHAEtrIc;IMti11HMEjjHHtZH=91zHtQH)H0L{=H=1H[A^A_]azOH[A^A_]vOlLH[A^A_]f.ff.H;=)H;=?) fDUHAWAVAUATSHIIdH%(HEHEHv+8FIMu)IE1HMLE1LLÅt 7HEȀt HMHL;AH}Ht HLP@dH%(H;EuDH[A\A]A^A_]UHAWAVAUATSHIIdH%(HEHEHu+8fIMuIIE1HMLE1LL.Åt 7HEȀt HMHLۆAH}Ht HLP@dH%(H;EuDH[A\A]A^A_] UHAWAVATSHAAHdH%(HEH}RE1}о1}Ծ1EII9E1EtRf}ԺHtn}кH+tYTHH!THL9r9fff.}ԺHtSHH!SHL9rA}}dH%(H;EuDH[A\A^A_]fUHue1]Ð[ff.H)H8H)H0ff.H)H8DUHAVSHHI)EH=)l(E)HHKHKWHCCLH[A^]@UHSPH MHKHHKHWHCCH5 )H HUHAWAVAUATSHIdH%(HEHEH )HI$Mt$H{L=)I?&H)LH;u$IHK(L9sHI)L9eA|$M4$MI\$H}ȾpbH]tZDH9)HHHHDʅHH H5 )uHcHipH )HH]H]LLLeHHuTM,$I\$AD$LAUHYq+8H</A|$M4$Mt}M|$H}Ⱦp_tifDH9)HHHHDʅHH H5 )uHcHipH )HH]M,$BAM=H]LLLWHLGM,$I\$AD$E1I\$H=i)DLHHIL$HDWA$ID$AD$H1dH %(H;MuH[A\A]A^A_]XNH563UHHo+8>Ht 1]f1ffff.1ffff.UHHeo+8Hu]fff.UHH5o+8込Hu]H4@HY)HHWGf.H9)HHHGHtHOHHWUHSPHH=)H HKH HKH H[]UHAWAVSPIHIH=v)QMIOH HEH1Ht1H9rL9r HIHuHH[A^A_]ffff.UHAVSHIHHLnHLZHLFH L2H LHL HL[A^]fUHAWAVSH(IHIdH%(HEHUȾ}u!HEHH9v HtH9sIHUȾL}u!HEHH9v HtH9sIHUȾ Lo}u!HEHH9v HtH9sIHUȾ L7}u!HEHH9v HtH9sIHUȾL}u!HEHH9v HtH9sIHUȾL}u!HEHH9v HtH9sIdH%(H;Eu H([A^A_]UHAWAVAUATSHIHdH%(HELH)L;0LC3LtIFIHHHHHHHpH0H(kE1LH0-AE|HH(HH HHHHHHHHL0LK0ʁNʉK0HLLLHLH(LH  LH LHLHzLHfEu M97uIAHHt>H0H(@)H?D+HcHH{AdH%(H;EuDH[A\A]A^A_]fffff.UHAVSHAdH%(HEHHPEHXQH9+HPYHHPEHXHA:+HP H9HPEHX߻H:+HPHHPEHX覻H:+HP讶HHPEHXHjH߉諸HL;+HP cHHPEHX"H;+1H,tH;tH;+HP HHPEHXȺH;+1HҵtH;tH;+HP诵z1At@HHPEHXWHP7+HP_<+ӹHHPEHXH;+HP <dH %(H;Mu HĠ[A^]gUHAWAVSPIIH<+~ 11LL?t H[A^A_]H7+HHt LLH56+1҉u蠨H[A^A_]ѪUHAWAVSPIIH<+~ 11LLt H[A^A_]H)7+HHtLL2H[A^A_]cfffff.UHAWAVSPIIH;+~ 11LL?t H[A^A_]HA7+HHt LLH5&7+1҉u蠧H[A^A_]ѩUHAWAVSPIHAH;+~+LKE11DHLt H[A^A_]HM7+HHt DHLH517+1DH[A^A_]CUHAWAVAUATSHIIAdH%(HEHj:+LuII\$>L)H>HH9H^+8}HtDEHHHHH{EtEDLLH{;uZ!ML$E11DLLu7H6+HHt DLLH56+1DƱ,dH%(H;EuHe[A\A]A^A_]H5"6S~fffff.UHSP蓥H56+1҉SH()8H[]ݰffff.UHSPSH5$7+1҉H)8H[]靰ffff.H8+~HcZ+H8H`(H2+HHtUHAWAVAUATSHIIAdH%(HEL%]+I<$tUA]o9uHH L7jHp]+Ht5HHA$HLoH6+HHt DLLdH%(H;EuH[A\A]A^A_]sUHH5]2+1ٯH52+1ƯH5g3+1賯H53+1蠯H5q4+ 1药H54+1zH5{5+1g=6+uH571+1KƳH55+1҉]5DUHAWAVAUATSHIIHAdH%(HELPLԳoL1LƳLKE11DHLJA$11L蚳I|$1dH%(H;EuHĈ[A\A]A^A_]UHAWAVATSHIAt8)0)@)P)`)p)))L(L dH%(HELD)H $5+HLqDžHDžLpHHHHEHDž0Dž ڃ1)1(wHcHfDHH~HH6H)sHcHfHH~HH6HH9wt7)sHcHHHJHH HLKLLTfHXHUHD蚮1HKHHLHDžƅHtHLk1HHt uHW)dH%(H;EuH[A\A^A_]6H^HHHt uHW)HWHffffff.UHSPHίH߉蔱u 1H[]2fUHSHdH%(HEHNHXEH`ԯHX1҉dH%(H;Eu HĨ[]FfDffffff.Ht@1HtfUHAWAVATSIWHup11E1E1LjjHAĻOEtDIc$IMt4111LMEjjOHD9u"1L,g1ۉ[A\A^A_]ÿOgL貈UHAWAVAUATSHXdH%(HEDžLLmWEHtVDžWW1E1EgLMH}I9t?dH%(H;EHX[A\A]A^A_]HZIMLfL辦HÃ|@HcA< /u A A<$/MMH CLuL}HcIDMu LLuH9Ev1HEDžDžH=HHI HI9Lu HE1HfHHdžHHdHI9uHUHHHiH]HHEHHEHHEHELL}B;H]HMLqHu HH]L9uv LuIHHH9Hu HE1HHqfHIMHH9uHUHHL葭L}LuHHEHHLuHEIfA/HEHMH]HEL4HHH]}dH}HH9txHEHHElj1]7dH}HH9t2HEHH]1HIL9uv LuIHHLL9HHu HE1IveHyHHL9uHUHHHH]LuHHEHH LuHEHHHLޫHEHML}H]Mu3LL}&cH}I9tHEL}1H9]v H]HrlHI9Lu HE1HseH聃IMHI9uHUHHL#LuH]HHEH]HEML'L芫tAlt tu1HL .Dž Dž1H}tHEHEaH}HH9tȂHEHHEE1>XH~HH}I9t荂H蕩H]ffff.UHAWAVATSH0IdH%(HEDžLL}WEMtVLHHrVHELce1LÁIMHUHHLqL}H]DžH]ALeHLLH4HEHMHHËu>A]`H}HH9tXHEH]Dž1&`H}HH9t!dH%(H;EuH0[A\A^A_]諤HHH}HH9tۀHHff.UHAVSHIHdH%(HEA3H'tp藣t 'tMuQHHX莥u#p=u A !HL AA1dH %(H;Mu HĠ[A^]蜣fff.UHAWAVAUATSH8HdH%(HELLmWEDžHt,HLt@LeMuLmML9uvLuDž8IreH@M9Lu HE1HhHH~IMM9uHUHHL蒦L}LuHHELuHEM11HMEjj#Ht>HcHEH9vHMHHMHHËu^aH}tHEHEDžOO3<]H}I9t>~HELmDž1 ]H}HH9t~dH%(H;EuH8[A\A]A^A_]菡HHH}HH9t}HǤHffffff.UHAWAVAUATSPHHHu HHHHǃw Hǃ|Ht4HIDHH9v HHH<.8"uiHt HǃH11IMt9L衛IELMu HIL9v(L+E1y[IrgI9Lu Hǃ1It$eHu|HHI9uHHIH£LHLHEHLHǃLILL聣HHL{DH[A\A]A^A_]ÿZHH9t{HǃHfDUHAWAVATSH0IAdH%(HELLuWELD9sHUDLKH}I9t){dH%(H;EuH0[A\A^A_]賞HٿHH}I9tzHH踿UHAWAVAUATSH(IAdH%(HELLuWELÅtIHU11E1E1ɉDAE9sLLt@L}MuLeML9uvLuzIreH@M9Lu HE1HhHHxHHM9uHUHHH芠H]LuHHELuHEL11LIEjjHt*HcHEH9vHMHHMHAUH}tHEHEOIW)MWH}I9tOxHELeE1$WH}HH9txdH%(H;EuDH8[A\A]A^A_]覛HμHH}HH9twHޞH覼fDUHAVSHdH%(HEDžTHtvwIMt}LsL詒臚tu~HXL臜uK#p=u9DžT  RDžT{{E1>DžTE1*HTLiTuDžTU1MtLvdH%(H;EuHĠ[A^]HUHAVSH AHdH%(HEHEHEHHMLE1HHPu#EuHE8tSH}H1HdH%(H;Eu H [A^]踙UHSHHdH%(HEHEHEHHMLE1HHPuHEHx`H}H1HdH%(H;EuH[]7UHAVSHIdH%(HEMtr記HHtM/H#Ht2;t*HXHbu$#p=@uAAAH蛓dH%(H;Eu HĠ[A^]{ff.UHAWAVSHHdH%(HE軗HzE1H }vHcHAApAH裗IAM/LAHt9A>t0HPLLu#h=@tAL蘒NAFA>A6A.A&AAAAAdH%(H;EuDHĘ[A^A_]#UH臖Hzw%H tI13HzH vHcHA1ۃt(E1zHjzHc HE1pYpILu1HÃ&A:3,%E1H}HH9toA8M/MIHJMu MMI9v IHHM9Lu Idž1HHrfHnHHM9u"IHHLIqLHIIHIHIIdžLf/IILMMIHMu MMI9v IHHHM9LuIdžE1HHreLHmIMHHL9u#IHLLPHHMHIHIIIdžIHLLHIIuI1ɀ8IL7mdH%(H;EueHX[A\A]A^A_]ÿKII9t"lKII9tlIdžMzn#H蔱IH}H9tl HyILlL薓H^HVfDUH臏t,ʃzw 1H wHcH]øp]ø]ø]ø]ø]ø]ø]ø]ø]ø]ø]ø]ø]UHAWAVAUATSHHEMljIHdH%(HEHDžHDžHDžHDžW)LHHEEHHAWMt|DžH5LuLωHLH}OtBHxpH}HXt(A7DžA"AHHH OE1틅y=t&=At=@AMt%A?IA]%9uwu4AHuHu @DDDHEHu-AFw$H !wHcHE1&DžE1EADžx荅Et H}EEHHtHHHHHtHH@@HHHtHH@@HЃADEADHHH9thH}HH9thdH%(H;E|HH[A\A]A^A_]Dž DžAE1E19H}1AADAā@H}1A"DAă@@ H}13AĉɉE1AwDsAE1WEAO!L=.+I?HHH+HLHЋt1AH}AE1E1AEHHH@HLHЋtA|H}@HHAHAQA1A HHHHLM HDžI?HH@HHH $H :+HDЋAHDžىHHHHHH9teH}HH9teHH蹪H豪UHAWAVAUATSHLMEIAՉIdH%(HEHEHQ3+8ڀHuHLUHLDMEARuuzH oHEdH %(H;MuH[A\A]A^A_]ֈfDUHAWAVAUATSHhLxDHIdH%(HEHHEWEHDžHw2+8HHu ߚHE1MtLIAH)D IcLmMu LLmH9]v H]ArlHI9Lu HE1HseHcIMHI9uHUHHL聋LuH]HHEH]HEM11LMEjjHteH]HcHEH9vHMHHMHHHLLDPSxmH YH}tHEHEOB7 BH}HH9tcHEHHEHH}HH9tbdH%(H;EuHHh[A\A]A^A_]PHxHH}HH9tbH舉HPUHAWAVAUATSHh|HIdH%(HEHHEWEHHH/+8Z}Hu@E1MtLPIAH )D0McLeMu LLeL9}v L}Ar~HI9Lu HE1IweHpGaHHH;HI9uHUHHHވHH]L}HpHEL}HEL11LHIEjjaHt|HcHEH9vHMHHME1HtH#IAHޔ)D McHHuHHHL9v,LH}tHEHEB?ArpHH9Hu HDž1MweL_IMHH9uHHHL苇LLLLHDžI11HMEjjHtBHcHH9v HHHHL|mHt HDžH">]Oz>H}HH9t_HEHHE;=HHH9t^HDžHH1HHH9t^H}HH9t^dH%(H;EuHh[A\A]A^A_]Hwtu6H`AEtH(H{A 2E1ERvttA AAlLH`AEL#F2H`H(HpuAH(pvIAM/LrAHt9A>t0H@Lxu#X=@tALeqzwaAHdHc HAqf1E1Au`iApVANAFA>A6A.A&AAAAA5uD(E1HHH9tQH(H H9tQdH%(H;EuDHx[A\A]A^A_]fuH茖H脖HHHH9tQH(H H9tqQHyxHAH9fUHAWAVAUATSHh|HIdH%(HEHHEWEHHH+8:lHu E1MtL0IAH)D0McLeMu LLeL9}v L}Ar~HI9Lu HE1IweHp'PHHH;HI9uHUHHHwHH]L}HpHEL}HEL11LHIEjjAHt|HcHEH9vHMHHME1HtHIAH)D McHHuHHHL9v,LH}tHEHE".ArpHH9Hu HDž1MweLNIMHH9uHHHLkvLLLLHDžI11HMEjjHtBHcHH9v HHHHL|Ht HDžH-=qOz,H}HH9tMHEHHE;,HHH9tMHDžHHp1HHH9tMH}HH9tlMdH%(H;EuHh[A\A]A^A_]pHHHHHH9tMH}HH9tMH tHԑH̑fff.UHAWAVSHIdH%(HEL0L8W@Ha+8gHuЂMLJkH0LH0H0QH8HPwqtH8gE1uKV#hA=@tE1=u"HPE1ɅD ADE nAH8I9tKdH%(H;EuDHĸ[A^A_]@oHhHH8I9ttKH|rHD@UHAWAVAUATSH8IdH%(HEHHEWEH+8lfHuRMt?LeHH #)HcHLcL}Mu LL}L9mvLmm5IrlHI9Lu HE1IueHLJIMHI9uHUHHLqLeLmHHELmHEM11LMAjjHt)HcHEH9vHMHHMLjH}tHEHE(lO=(H}HH9tIHEHHElH}HH9toIdH%(H;EuH8[A\A]A^A_]lHHH}HH9t'IH/pHUHAWAVAUATSHHIdH%(HEH H(W0H+8 dHu~ۻWHMLHH |)HcHLcL(MuL L(L90v L8Ir{H I9Lu HDž(1IueHGIMH I9uH8HH LioL(L8HH0L8HDž0M11LMAjjHtzHcH8H9v H8HH(LHE1GLCH@LdltELXÅ H8t HDž8H(O%H}HuN-HHCH}Hu6-HC H}Hu%-Lc LsHCLLN,HLyyII$LL-,yIIHpHA H AAJ)%H(H H9t!FHDž8H H(iE1H(H H9tEdH%(H;EuDH[A\A]A^A_]hi H芊HH(H H9tEHlH_ffffff.UHAWAVAUATSH8IdH%(HEHHEWEH+8v`Hu\{MnLfHH $y)HcHLcLeMu LLeL9mv LmIrlHI9Lu HE1IueH]DIMHI9uHUHHLkLuLmHHELmHEM11LMAjj萙Ht/HcHEH9vHMHHMLbH}tHEHEW"7"H}HH9tCHEHHEf1H}HH9tCdH%(H;EuH8[A\A]A^A_] gH2HH}HH9t:CHBjH f.UHAWAVATSHAHdH%(HEH+8=^Hu#yAE1HHfAE1HIL?HHLguK`fx@AtCAu mA9t*L-]tLAE1Et QeD E1L`dH%(H;EuDHĠ[A\A^A_]efff.UHAWAVAUATSH(LAIHIdH %(HMHEHEHEAWHHAH9u)AWMH [+H9LH .*LMA@LHAR(AEuiH}HHMLE1LPAEuJHEAx t:EH}HE11LHEHED}LgxLH}Ht H1LH}Ht HLP@dH%(H;EDH([A\A]A^A_]cD8Izw HSJc HAApAAuAjA_ATAIA>A3A(AAAcUHAWAVAUATSPMIAIHHl +8ZHuuHHLDMMÅtb1H[A\A]A^A_]ÐUHAWAVAUATSH(MAIHIdH %(HMHEHEHEWM A$HWMMH +H9HH *LMALHS(ÅH}HHMLE1LPÅuyHEx tjEH}H1LHEHEE}LL[y,`aHzwuH pSHHc HA$1H}Ht H1LH}Ht HLP@dH%(H;EuxH([A\A]A^A_]É뷻p밻멻뢻뛻딻덻놻|rh^TafUHAWAVAUATSPMIAIHH +8XHuksHHLDMMÅt)`1H[A\A]A^A_]ÐUHSPH +8*XHusttuHp)$Hp)Hp)_WHH[]ffff.UHAWAVATSH HIdH %(HMHEHEHEHH (+H9HH *LMA@LHS(AE1E{H}HE1HMLE1LPAEUHEAE1x >8E11#aIMx?HEȋ8L]^D IzwZHRJc HA^D Izw1HsTJc HAAApAApAA~AvAnAfA^AVANAFA>A6A.A&AAAAAH}HI9ƻWAFApAEHt H1LH}Ht HLP@dH%(H;EuH [A\A^A_]]UHSPHH+8YUHu?pHHtÅt ]1H[]fUHAWAVAUATSHIAdH%(HEиWML8tA$H AI Lc1D^IƸIu MuLLxu9My4H@D|WtULHٸH9p|ADL_^HxMt HH A $H811DL0^dH %(H;MuHĨ[A\A]A^A_]E\DUHAWAVAUATSH8IAHIdH %(HMHEHEHEAHDELMH '*H9HH *LMALHS(AEu:H}HHMLE1LPAEuHE8DLMLEAH}Ht H1LH}Ht HLP@dH%(H;EuDH8[A\A]A^A_]2[fUHAWAVATSHAIAHdH%(HEEH +8RHuymLMHHDLEÅtEADu#ZdH%(H;EuDH[A\A^A_]Zffff.UHAWAVATSHAIHIdH%(HEHH EEHP+8QHulHMLMHLEÅt |Y1Mt MAMANdH %(H;Mu H[A\A^A_]Yfffff.UHAWAVATSHIIHIdH %(HMHDž@HDž8HDž0H H *H9HH y*L@ALHS(ÅH@HH0L81LPÅH80HHSt$TXHzw@H-PHc HmHxA$1Mt[H ARpKD=6/(! H0Ht H1LH@Ht HLP@dH%(H;EuHİ[A\A^A_]XUHAVSHIHdH%(HEH+8tOHuZjHUHHLÅtWEEdH %(H;Mu H[A^]}Wffff.UHAWAVSHIIdH%(HEHY+8NHuiWMtHUHMHL[ÅtAzVEAEAGAdH%(H;EuAH[A^A_]VUHAWAVATSH HIdH %(HMHEHEHEHH *H9HH *LMA@LHS(ÅuyH}HHMLE1LPÅu\HEȻx tM8Rt>UIL%XO@AHzwwIc LHEȋ8YRu1H}Ht H1LH}Ht HLP@dH%(H;EuyH [A\A^A_]û붻p믻먻롻뚻듻댻녻{qe]S/Uffffff.UHSPHH *8LHugHH$ÅtYT1H[]fUHAWAVAUATSHxHhHpIHdH%(HEHHEWEHHH}*8LHuf*u1Xfffr*i*Ht5;t0HhH5OHH Hr{sS fS 1HHH9t&0H}HH9t0dH%(H;EsHx[A\A]A^A_]SWH III LMuHHIL9v LIrsHI9Lu HDž1MweL%/HHDHI9IuHHHLVLLLLHDžA$HLxLHVHL9v LLHHxHMD*E1LLHxOHEH9vH]HHMHDžH*8`HHuFcHH@AAHLSjjH A$LHptE1HE1A$LAm AσIL*HffEf8*A$Hu1LHxNHDžH*8iGHuObH@AAHLSjjH |H tp>DH}Ht HLP@H}Ht HLP@H}Ht HLP@H}Ht HLP@dH%(H;EuHh[A\A]A^A_]EUHAWAVSPIIHH*8=HuWHHLLÅtD1H[A^A_]DUHAVSHL)H0H=U)HHtXHL)H0H=U)tIIt1HL)H0H=jU)UHHu8H_CLHRCH'U)H$U)H!U)1[A^]f.UHAWAVAUATSHXHIdH%(HEHe*8;IMuVIHEHEHEHEW)EHEHEH;1۾11GAAL-*I}HH*HMLELÅH}HHMLELPÅumHE@D8@@@ H}HLHEI}HHUHMH $H d*LME1LPHEH}Ht HLH}Ht HLP@H}Ht HLP@tAtDI;HEIHEdH %(H;MuHX[A\A]A^A_]BfUHAVSH=S)HS)L5S)HR)HR)HR)Ht@HtH@It L[A^]@[A^]UHAWAVAUATSHIHdH%(HEHDž8HDž0HDž(H*8z9IMu]TIE1AHH*H8HH *L8ALHP(AEsH8HE1H(L01LPAEDH00H@;t-@D(Iz|HK<Jc HA#XA=@tAE1=H@/1ɅD EAH}Hu}MwIGH}HuhMo IG H}HuSI_IGLHyHIEHLjyHI@AGHpAG$H AG PAG(AG,HAG0AE1H(Ht H1LH8Ht HLP@EtI?D(dH%(H;EDHĸ[A\A]A^A_]ApAAAAuAjA_ATAIA>A3A(A&?fDUHAWAVAUATSPIIHLMu HIL9v L~IrcI9Lu Hǃ1IveHuIMI9uHHLHpBLLHEHLHǃMILLL/BHHH[A\A]A^A_]ÿ_HH9t^HǃH1OH H ȋVH H 1H9¸MUHAVSH HdH%(HEI>ޱHu1AtL36HMHiu؀LH ףp= ףHHHHH?HHHHdH%(H;Eu H [A^]4=@HiπH ףp= ףHHHHH?HHHH>ޱHH*!NbHHt5HBzՔHHHHH?HHHi€HH)HkdHHBzՔHHHHH?HHfDUHSHHHdH%(HEH>ޱHEOH H HHH9sWv1H*!NbHxHBzՔHHHH)HBzՔHHHHUH}Hu8H fKHHQfSH lf HfK H fK @fCdH %(H;MuHH[];f.9ff.UHAWAVAUATSH8IIdH%(HEDžHH*82HuMM0M8`HH3HHHW@0 HǃPLƅƅ.ƅƅHHHALMhPh 6H DEt0H*(9HuH?9H_Ht H8H5Hu3=Dž DžWWDžHdH%(H;E=HH8[A\A]A^A_]ÀtH4DH56H3L^4*"uoHH1LLA*u6HHH L uc uo1H*rHLLA*u*u&HrHH L[t HH8t0HHXHLH[L7IMtLHL谞ui/L3HtWHL>9u#=u Dž L2H^wOJLf2B\7fff.UHAWAVAUATSHIIdH%(HEпIEH[M9mQIX1HFL9M.IEHIID$,HID$H ID$ H0ID$H(L@L8fffff.H11ALHIhAVh2H OHL:LA$HH;u_AƄ$0LL@L7tgLL4IXtSIXL8ML801dH %(H;MH[A\A]A^A_]IXH}HuJL IH}Hu3L0IH}HuH(HLHGL8yHIHL+yHIHpAD$ H AD$>4ffff.UHAWAVSHXHHdH %(HMHHLAHjj3fHHHIIICHHCCfǃ4HH,11AIetUM0WzuO IdH%(H;EuqLHX[A^A_]zuOIFHrM96t WIItLH1LE.>3fffff.UHSPHHCHrH9tWN1H[]HHt Hh1H-fUHAVSHPHdH%(HEHVA1EtxCHHCCfǃ4HH,11AIhcDulzuOf1dH %(H;Mu HP[A^]2@UHAWAVAUATSHLXAIHxIdH%(HEHH]WEHHE1Mt L,ILHxHt ,DAMDttL|,DAL`McArBHEMwe1L= HHHUHHH4H]L} L}AH1HLuAt +1IHxHt+HAT$E1H`Ht.ILMMA+DMMLLIBD)D9EHh~oAEHcHcH߉H7HhIcHD)3WH}HH9tR HEH]H߅H~2HcAHcAHx6DHhu-HcH)E~HcAIcHH``6HEL9vL}LHMEMcLMuLLL9v LArpHI9Lu HDž1M}eL" IMHI9uHHHL2LLLLHDžMLHH [t]t uD\H L)HH9v HHHE11L狵tHXH,AH3H{H -AEEAMHHH9tE HDžHHAHHH9t H}HH9t dH%(H;EuDHĈ[A\A]A^A_]-HNHNHHHH9t H}HH9t H0H`NHXNUHAWAVSPHL>HL-A1EtiH5dH,tOH5dL,t5H5J*H,tH52*L,DDDH[A^A_]UHAWAVAUATSHXIdH%(HEHHEWEMtsA<\HHtH}HH9tHEHHE1ۿH}HH9tdH%(H;EuHe[A\A]A^A_]S!HyBHH}HH9tH$HQBUHAWAVATSAIHHt4HE1tIHLIAMt6E9vz%W E1L9tDLHOAD[A\A^A_]fUHAWAVATSAIHHt4HoE1tIHLIAMt6E9vz%WE1L9tDLHNAD[A\A^A_]fUHAWAVSPIAMt?H=tLD)t7D9sVHA</tNXD9wFA/A4W17ArDH L%D9r zH[A^A_]f.UHAWAVAUATSHIdH%(HEMtkHeȅAݸIEHHH!II)LH=L;t<9s]HA</AtUD`A9wLA/A9WE1ArH0LL$AAA9s.EtEEL$11LMOu1O"zzfA fAE1HedH%(H;EuDHe[A\A]A^A_]ffffff.UHAWAVAUATSPHLLMu HIL9woIr[I9Lu Hǃ1M|$eLIMtwI9uHHLHl!LLLHǃMLHL9v LLHH[A\A]A^A_]ÿeHH9tdHǃHE1ffff.UHAWAVATSIMRE1LE1fffff.H\tfu f.f/f/Mt/*tR.tŃ/D%.|E1Hf.uL9fDcIHE1H|HL)HhC*ufC.uiL{HGHLHE1H3HGHTLHLE1H fE&LME1HE1HMtM9tAG/tfA[A\A^A_]fffff.HufHHHH9tHDžHHE11HDLADHH9v HHHLH`Et1LVY;'AHI9Lu HDž1I\$eHIMHI9uHHHLyLLH[HHH9tHDžHE1LHDžM1HxDLADHH9v HHHEt 1Lt$E1 nE1W\tA9s0HhHt>LE1!AE1E1WHHH9t|HDžHE1M>HHH9t6HDžHHE1eHXHtY/Hh HHt@HH8H}HH9tHEH]E1HHH9tH}HH9t|dH%(H;EuDHĈ[A\A]A^A_]H)2H!2HHHH9t$H}HH9tHH1H1UHAWAVAUATSHIHdH%(HEHHEWEHHH`HpxHtMt%H1ۿW^1ۿWP 1ۿWBHpH`H9t:HHH9t"H}HH9t dH%(H;E Hĸ[A\A]A^A_]ÉIcH9I1Mt)HU11ME(Lu L1H}I9tHDL=|*GLHHcH1HADA+AA11K1DKjH O)*H C)H=HHtD8IA1HA?L={*uH=@@HMH{*Hb蝯H蔔}H[uHHHs!!7!HH&HHHH{*OH HøHHHP(HHƃHJ(HHfvǃǃHǃƃxH!HHHP@HHE1Hy_DRjDAAĨtHIIE1uqHDo*tYt !tFhat8_t/AA1!LNLLAH0g2*D*j_H9E11HLHHH5y*&tȮdH%(H;EuGH[A\A]A^A_]H*HGH g*HHH&n=HeHH}HH9tmHuH=ffff.111DUHAVSH=HHt=@IA1HA>uH=@@HMHw*H[A^]UHSHdH%(HEH}Hu?Nt 腭pHw*Ã| 11vSZtEt1ɅE)u,HH=1HdH%(H;Eu H[]@UHAVSHdH%(HEH=111AAt]HD1H~:ƄH5ZHHtH 1 Hl1ۅDdH%(H;EuH[A^] ff.UHAVSIHH*8HukHtLӉH[A^]f1fUH1DUHSPfff.Hu*fffffff.u*Hu*u*uUHu*F]Hdu*DHUu*fD1H=Vu*t?UH1=Ou*uH*8wHHuZHH5 u*+]@H=u*t:UH1=u*uH*8)HHu HH5t*]"f.UHSPHHD(HHt H{(H{ HHt[]#[]HHUHSPHHxD(HHt H{(H{ HtHH[] HUHHdH%(HEH*8=HHMHt1huƁh H}DdH %(H;MuH]Zf.huƇh1ffff.UHAVSH IdH%(HEHEX2tfH}6 ÅuWH}HUH ÅtH*81ZH}&H*H8HHuHUP H}H[1HEIdH%(H;Eu H [A^]sUHHdH%(HEHE1tH} uHEdH %(H;MuH]fDUHHdH%(HEH*8HHMHt1huƁh H}dH %(H;MuH]f.UHH*8.huƀh]fff.UHHu*8h]DUHHU*8H1Hthu Ɓh]ffff.UHH*8htƀh]fff.2ht Ƈh1UHHŕ*8Nhtƀh]fff.UHH*8htƀh]f.f1 fUHAVS1ۅH?IMLH5wLHkIE1tH*8HHubHH5p*3HHt1HHH(~ Wĥ1I~趥11tHr*8HHuHH5lp*L7H[A^]ffffff.1 fUHAWAVAUATSH8IdH%(HE1ۅ/HH]WEMt?fA>tILlHH N(Lc9LLeMuH]IL9}v+L}1ۿ~1ۿW诤Ir^I9Lu HE1IweHOIMI9uHUHHLLmL}HHEL}HEMLH (11LMAjjuHÅLoHcHEH9vHMHHMH5LL5ME1tHv*8HHuHH5pn*LHt(HLA HG1ۿWKA1ۿ~=1tH*8HHugHH5m*H}HH9tdH%(H;Eu=HH8[A\A]A^A_]ÿŢH}H9tHEH]1bHHH}HH9tHHbfUHAWAVATSHIHdH%(HE1tH *8HHuxHH5m*IdpMt/A>t)Hzm*Hffffff.H9tHI0H9u W H9teʡE1"1tH*8HHuHH5l*dH%(H;ELHe[A\A^A_]H m*HHtHKH;HuuL.H III ID$HII)LHLL5uLLLt z&H{LIMuH{LuIMt=H{H{LHH HCAUH1tH:*8HHuHH54k*]vfDUH1tH*8HHufHH5j*]fD fUHAWAVATSAH:1tH*8&HHu HH5j*H*Au;Hk*Hfff.H9t HI0H9uL#I9tN^E11tH*8HHuHH5j*&D[A\A^A_]ËC tȉC uHC0HK8HA0HC0HH8HEtH{(t 11H H{t#H{H5aHtH{HCH{HtH{WLO/f.UHSPs fff.UHAWAVSPAIH1tH *8HHuwHH5i*HHt/Hi*HfH9t HI0H9uH9tLHUi*HHHKHDHHt)11MEjjHÅuzO蓝11tHO*8HHuHH5Ih*\H[A^A_]ffffff.UHAWAVAUATSPAIH1tH*8pHHuSHH5g*$EHCLLHt&HKh*HH9t HI0H9uH9tFH%h*HHHKHDHHt#HZAE9}gLLH(E OiE11tH$*8HHuHH5g*1DH[A\A]A^A_]ÿzUHAWAVAUATSH8HdH%(HELLeWEHt>f;tIH7 HH (Lc9LLuMuLeML9}v+L}1ۿ~苛?1ۿWz.Ir^M9Lu HE1IweHIMM9uHUHHLLmL}HHEL}HEMHg H J(11HMAjj@HÅtFL>HcHEH9vHMHHMLHHuG1ۿ~肚9k1ۿWo&cH}I9teHELe1H}HH9tBdH%(H;EuHH8[A\A]A^A_]HHH}HH9tHHfUHAWAVAUATSH8HdH%(HELLmWEHtEf;tPHH HH (Lc!LL}MuLmML9ev+Le1ۿ~D1ۿW3Ir_M9Lu HE1It$eHҹIM5M9uHUHHL{LuLeHHELeHEMH H (11HMAjjHÅLHcHEH9vHMHHM1tH*8HHuHH5c*R HLHf1tHɆ*8RHHu5HH5b*9迗1ۿW×&跗H}I9t蹸HELm1H}HH9t薸dH%(H;EuHH8[A\A]A^A_]HEHH}HH9tMHUHffff.UHAWAVSPAIKH1HtnH{(tdH{u$H{H5Ht LHCH[AHҾHu!HC(HZ蘖1HH[A^A_]UHAVSI11ۅ1tH%*8HHuHH5a*b L5HtHLUH ~1_1tH„*8KHHu.HH5`* H[A^]UHAWAVSPIIH!a*HfDL9sH[0H9u@öHHLڱHt{LsC HHCC$WC(HC8HCH5(LHC(H`*HH8HK8HC0HH8HY0HX83C tC LLHؔL01HH[A^A_]1fEff.HtVM1UHH0dH%(HEHtHutHE Y1dH %(H;MuH0]ffff.ff.UHAVSH=^* H~_*HE11HCHt;HCC fHnfpDC0HC(HCC$AD[A^]UHAVSI1tHT*8HHuHH5N^*H^*H{Ls1tH *8HHuwHH5^* [A^]fffff.UHAWAVAUATSPIAL%*A<$H[A\A]A^A_]LH[8{$tH{(tHDLQL9ug1tA<$XHHu;HH5\*H[A\A]A^A_] fffff.UHAVSHpdH%(HEH}ȉuHUEHEHEEHEHEHEHEH}.H+(HEHEHEH}bH]HHxH@(sHSЉCCH}EdH %(H;Mu Hp[A^]HHIƿHHIHIH}u@L$Mu HMMtH@>oI,LH\fff.UHSPH1tH*8HHuHH5[*RH~*u0H[*Hf.H9t HI0H9u H9uC$?1tH~*8+HHuHH5Z*H[]UHSPEHHt(H{H5xHtH{1H[]1H[]fff.UHAWAVSH(dH%(HEL=Z*IHH=HuL5Z*I>u:H}HHH'IHHUHHH]H5HL5LE1tHb}*8HHuHH5\Y*LrHt1HL0H ~A11tH|*8HHuiHH5X* IIdH %(H;Mu H([A^A_]DHGHHf.UHH0dH%(HEHu"1HEEdH %(H;MuH0]=f.UHSHHdH%(HE}H 98s5H HcH5LQH}H1HtHHcH HHdH %(H;MuH[]9| v19@1H a'(HDHDfDHt HG?HD1fff.UHSPH1Ht.t%{t4HHHH[]ff.f.UHH dH%(HEt 1H &(HDHDtHMHMH@HEfE??fM@8w @8fM@8w@8s}fMts@8w@8shfMt^@8w@8sSfMtI@8w@8s>fMɸt1@8@8$W W1dH %(H;MuH ]fDf.1rtufff.UHtuOHtJ1H,%(HDʅHDʁtu,AAFHAHFfF?? W71]1ffff.UHAWAVATSEMIԉtWMtMtIExDt Mt=M9t8tu,y LHLLDA[A\A^A_]W蟉1[A\A^A_]@UHAWAVATSEMHLetPHtF|AExD%= D%f=`fffff.DAr4DhA@A u\AAAfDALL) "fM9E&IEyfHMDDAu;_@wH AA A A A A@G@D A+rMAHu H HH}HHEHAHALDHHH}AE1Hw@AAHH II&II,H2 E E A A A @AA@E1M9AMNAtAVIMAtAf€IM92AAA оuBIYL9s$AQAA I1%@LEIffff.@t@@IM!@A%=Mq u v?փ Au)ftU=`tKu=I)ƃw*uAA$%=,I? t %=AE0 I?f HHUIMf:HHUIL9IaHE^^HMHH9rH DHHMȁs@~HMH9IIHIwցuS1HyH}ȉu{ 2$AMIʼn ?ɀ AMHIʼn?ɀAMH?ʀAUIHMH9Lv HHMLH;uAIMwHEH8HIHEIGMwAGAGAGAG@Mt$AtILPA|(ILPHEHHHMA|HHEHEI9t HMH9Mr>I9uH} AGdH%(H;Eu4HEA)DH8[A\A]A^A_]ÿH5(1Hΰ虯fG f.fG f.f Gt G G$1UHf.HO HH ɉO G$xu G 11Åx ;G}HfDGUH5H5(1H@HO 1|HH x ʉW$AG f.fO 1IDG G$HGfUHAWAVAUATSPIIID$HI$D))LDAtyII$LPft_E1퐉u(Au EAt GfEt@E1I;\$s!fHI$LPfuAuIE1DH[A\A]A^A_]ÿH5(1HЮGf.fUHSPHHHPfuH[]f.UHAWAVSPIIFHI))L1ۄtbILPftTE11ېu(A%=uEAt1fDEt&E1ILPfuAu H[A^A_]ÿH5(1Hڭf.UHҬH5(1H豭UH, G(O,G0]É%=u'G0HDG u QifUH%=u(%=u,/G(G,G0]ÿ H5(1HO,AG,G0ɉG0xu G,11Åx ;G(}HfDG UH觫H5p(1H膬fDG,|O0xɉO0G,11f.@O,1IDG,G0HGGDUHSPHH{HH HH)HȉuQH;KsKDDǁu6{tDKAy{A}pHH L AH߉AQ${tKQS}2H H߉CH[]ÿsH5<(1HRHgAH8UHSPHHHPfuH[]f.UHH5'1HUHH5'1HUHAWAVATSIIH0(HIMLIE~nIc11ҐA4Lu+Ӏu(@t'0ffffff.@tfDt01HH9@|uI~LɹE~ [A\A^A_]ÿH5'H5(1HΩf.@UHAWAVATSIIH'HIMLIE~nIc11ҐA4Lu+Ӏu(@t'0ffffff.@tfDt01HH9@|uI~LɸE~ [A\A^A_]ÿH5'H5'1HΨf.@UH b@@H 'HH]1f.UHAVSA։ zfDpH5'1HRfUHAWAVATSAAԉ%=uFD%=u7 &IAH5LEzH5#'1LH5'1HΧHLHf.1f.1f.1f.UH%=u%=ufWfODG]ÿXH5'1H7UHH 'HH]f1f.UHAVSAHHDpH5'1HѦ1f.1f.1f.UHHIdH%(HEv_wDGH tJG@!ׅtv  E? E?ʀUAUAHHuHLDP0dH %(H;Mu]H]Åt:  t/ E?ʀUA뚃놃xd@UH蒤H5k'1HqUHrH5K'1HQUHAWAVSH(AHIdH%(HEHEHEHEt#HHuHPucHE؃xtH8螝EuLHHMLEкHLPu/HEЋ8tHE1H}HLdH%(H;Eu H([A^A_]Nfffff.UHAVSLH:B wHH  4E11OAE[A^]DUHSPHH?HtzHH[]H?ȝUHAWAVAUATSH(MDEMUIHdH%(HEHEHL*8HuA2E1Mu,LUHHLMDEDMARj@HAL}蠡D dH%(H;EuLH([A\A]A^A_]UHAWAVAUATSH8DEHIILudH%(HEW)H MtLVLHDžHDžHDžHDžHDžHDžHDžHDž2MtA~WEAunHwbsXIu tIL=3D*I?HH(*HLLuHHHPHHt HLHHtHLP@AtDݘHHt HLP@HHt HLP@dH%(H;EH8[A\A]A^A_]II?HH -%*LALLP(>HHHL1LPÅHHPG]HQH=HHHH8OH1L`AƋAD $HHHH @Qw HcH HHHHLLPÅH]HD0HHLHDžI?HHHH $H &*LLIPHDžx H811AHHx諝HHHHH8Ht H1LH0DvODH`uWHuMDH HOHH1LHOuL`;s)Ht$Hu$DiDDQ'AH@聗EuHcH9pu Dz1\H1GO;W)0) )))))))E1H˃Àt)E1HOHtiAA9rD;t"HD)HHt5H1DDkpD萛ptރztٻODfUHAWAVAUATSHLMEAAHIdH%(HEHEH0E*8蹒Hu蟭LUHLHDEEARuHTHEdH %(H;MuH[A\A]A^A_]軚ff.UHSPHHD*89HuH۸W2D1H[]ffffff.UHSPHH`D*8HuϬH۸W2D蚙1H[]ffffff.UHAWAVAUATSHMAAAHdH%(HEHEHC*8mHuSHMH $HHDDEM4Åt HEdH %(H;MuH[A\A]A^A_]pUHAWAVAUATSH(MAHIdH%(HUHEHEHEHEEl$WAA AAH 6<*H9HH *LMLHES(Åu_H}HHuPÅuKH}HHMLE1LPÅu.HEMuDpH @Att AuStNWH}Ht H1LH}Ht HLP@dH%(H;EHH([A\A]A^A_]Au WuAu uAt uAu sH5*L@AuHED14OAAIcH bHED1E1LƏIŻIth8sHHtFLkLs Dc(H}H{HP8HC0H*HHHHKHHXHEL(1LLOH5*L1UHAWAVAUATSH(MLEAAAHdH%(HEHEH@*89HuMt W-HMH $HHDDELMÅt•HEdH %(H;MuH([A\A]A^A_])fUHSPHH @*8詍Hu菨HH$ÅtY1H[]fUHAWAVATSIIH5*#MtyH?*HfHH9tcL9{uHtXHs L聖1ɃAODEHHKHHHLcHXH5Y*LMt$I$LLP@H56*LfAD[A\A^A_]@UHH= *H*fHnfpD]@H=*@UHAWAVAUATSHIIH>*8KHHu.HH5*HH*L0E1I9L}H]fffff.MfM~ HM9wAD!LL9wM6L;5(uH]E1tAL}MtaHL!H)M/AGI_AG AF(t"Pr҃EAO$AG(H]H5*HDH[A\A]A^A_]UHAWAVAUATSHHdH%(HEHDžHDžxHDžpHT=*8݊IMuIE1HEHa6*H8HH 4*LALHP(E1HHE1HxLp1LPÅHpD811D[H"Hu@D!H@Hc]1DH&H9HDH=E1E=MZPHE1PE:E1= %DE1MHILHH9ȻH8H5*L*IHH!LIMLu11ҹ"AE1HɉIIIHHPE1LLE膉HhHHHM8mHHHhHCL`Lk C(LPIELP8LkLs0H Z*HAH HCHHYHhHcAHXH!HPH)H)IH`H4DXDEII8jHH2HLhH`HH 1Xt/XtXu XIAE(H0HP8H0IEMu0Ho*HHAIMIEL(Li uHh@LPI)JL(HH!H`DHh(H8D9Q1H`H;HL8iIM HHH`H)IMIE AE(ILP8M}Mu0H*HHAIMIEL(LiHxHt H1LHHt HLP@t1MtL1LdH %(H;Mu[HĨ[A\A]A^A_]KE1?E1HhLIOH5<*LlQ"OLH`OUHAWAVAUATSPIE1MH5*8uIMuXIH5*L&HG*H1HrHHqHHHH9t H L9z0uH5~*L设AHtLAE1f.L+H{Hs @EDH{Ht HLP@HMLuDH[A\A]A^A_]DUHAWAVAUATSHMDEЉMHI}H+*ȃ)HcL<@IL%Y*C HtHLH!H!H)蛃LE1MDH $*ဉ)HcH IHM Ld L| Lt Ht D (D ,``EЉT LH5 *YWE1LH[A\A]A^A_]H5 *LHʲHHuLHuȋUDIH5V *Lnfff.UHAWAVAUATSHMЉUHHL=#*HuHD>LII!I)H}HuHE%@t>MIt.Hc #*L9r L5{#*K &H p#*D)s#*MuY1ҹ"AE1HLzIItHt%I9t ρLLn輁fE1MMt^H}u$HEL`H"*MIHLH!I!I)HLUԋM}tM_OLLނE1H"*ȃ)HcH@HL5X *A O~MIDHEIDMlHEID EAD(EAD, EALLH[A\A]A^A_]fff.UHAWAVAUATSHxAIHL!*tLHHH!ID=IDH!H)KLLHH!1L=!*MUHht*fI_H9wIwHH9M?MuLDHE1HL=N!*MtFL:!*LHIT H!IDH!H)fI_H9wIWHH9w!M?MuOEE1HEIHEH)1HIHHـIW(Iw0ȸ CȉMD4DpED<DeLxw!HHcHHuEDU#A@HuEDUu1 IG1H5 *H]H)1HUH9ILEHEIL9Ẽ}LEA HMffff.HAL9HMssIO(IW0HE1DN4(LHD41ACF$*E9uCD9u>Jt(IL9rLIIDE#ffffff.AIDEIHMH5)*HHIGIAHuHEHu2MHUIw(ND*HHMIHHt)H I9uAH A">J>HLH)t%HHuLELMuLMLEHuAH:ABHUI0H׋uLuALEHuHEA D;Mt3HtRH}I0uLUuLEA M9LEAHMHAL9HMssIO(IW0HE1DN4(LHD41ACF$*E9uCD9u>Jt(IL9rLIIDE#ffffff.AIDEIHMH59*HHIGIAHuHEHsBAMtYMW(HEJT(HHHHHLEHuA HMt:H HMH9u-H }" A:uLEHuHEA eHU HUA:HHH)t+L׾LpsLpA ALEHMHHMA HuHED;Mt-HNjUrtOH}I0uLRsLEA M9LEAL5*LuMwDeLxH}E% E1 EDeLxtnHu{L9=*tIGHtIHIHt HAIHn*IHtH@I(uIG(I0uL|uE1H"*ȃ)HcH@HL=*A vMIDHhIDMtMl EAD(Ed,00EALLHx[A\A]A^A_]fffff.UHAWAVAUATSH(UIHH#*8XqIMu;IH5*L HH]LmLeEf%@uE1AEfL=*M?MHMt]IH9wTIwH>H9vMzL9=*:IGHtIHIH9HA08xyMtiL%t*MtPH`*HML}J 9H\HI!H!L)ff.ID$L9wID$L9M$$MuwO wWE1DmEA AH*ȃ)HcH@HL%*A tIDHEIDIDHEID El(AD,1ED PADH5)H}DH([A\A]A^A_]E11ҹ2AE1LHoHttM+|$H5*1LHHAH9HI\$(1HL|HHMIHt@HI9u)AH A" ;fvO ;HLH)t H1nAHVAB #sIHm*IHtH@I(qIG(I0qL{q2fDH!*UHAWAVAUATSH(HAIIHL *8mIMu踈IH5>)L膥Aƈt,WC11H5)L2H([A\A]A^A_]HH]H *HHMI!J|9H!L)L=o*1MH}t)@IW1I9rIGHL9M?1Mu1HEE11HEDLHult/t1ۃ 6HEȄI0HUЊ 1wHH hHHMDȀH°Hc HE1LH)t1HI1HHHI9s.Mt[Iw(LHH$s:HH9rHELE /RHE@>-A@u1 H"lUHAWAVAUATSPIIIH*8{kIMu^IH5)L,MtI/w sK s;LB*LHI!H:* HHHKLH)H{HL9v1IILS(L[0G #HDA!ЉEԸ D1HII9ĿsD1LHDA42ֺ C9uG8 #u LII9rƃ}C AFM.tBAAw6IH&LLu#M.IFAF 1AF$I~AN H5o)L臥0H[A\A]A^A_]HIfff.f.UHAWAVSPIIH5 )T1Mt+Hc *1L9rH*J ;H *D)*H5)LHH[A^A_]D1HtHcW1H9rHGH0HW)Of.UHAWAVAUATSPIHX*8hHuǃH=ۗH9rHAE1H9wH@AHAy1ҹ"AE1HL%iIIt,HtGI9tB-pLLqI+ pIfff.M&MuOILIq11ҹ"AE1hHIAHE~1twjqHHHHHHHH?HI*HcHHIND)%AF&oIH[A\A]A^A_]f.UH1tipHHHHHHHH?H*] nff.f.f.UHAWAVSPIAHu0Du%LDKHHt/Au1HLf W)1HH[A^A_]ÿfDUHSPHutW)1ۉH[]HһtHJ@UHSPHt tW|)1HH[]Ht#HɾHEH'JHHuտ11?)ffff.f.UHAVSIÿtW)1[A^]HljL[A^]ffffff.UHAVSIHuY1HHL[A^]W(1[A^]@UHAVSI1Mt11HLIEH[A^]f.fUHH=H *HH=H *H]fffff.UHH *H8 IH *H8]Hffff.UHAWAVSH(dH%(HEL=_ *I?HtVgHHHHIMt:ILHqHWLH{pHuL/=LuHuHEHuȿ +kHHH EHMH9HCHEؿU5fHHt%"fHtHHMH9HCHEHEHu HE1dH %(H;Mu H([A^A_]k@UHAWAVAUATSH(IdH%(HEHE1M;H% *L8MtjLUfHxdHHtQHLkH1fHn_bytesHL#HL;AHeEH=dH5@mI1MH}HuȺ Lxb1HtnHEH}L%=LmLLr11LLrIiIAE11LlIM&A}uIILZkH}edH%(H;EuH([A\A]A^A_]ifff.UHAWAVSPI1MtVH=`IM~BH=LHH~.I9~1LHH9ȹLAAH[A^A_]fUHAWAVATSH IdH%(HEHEHEHuHUE1H}t~HEHtzLIE1MtbH} dHLdL|L3EIMt3HULLnH}LhtLLLl1E1LH}DH}DHDdH%(H;EuLH [A\A^A_]Th@UHHH=HHJh]UHHH=/H*h]UHAWAVAUATSHHIHIdH%(HEHEHEH={H5FjHrH]L}H}Hu HEH|_1HMHHEA1HEL-?E1E11HE@LMt LmM9vULCH}CH}HCIMAkH}HtCHHMHFLmMMH}H5:dHI1HH5LLLEMfLH5Y`IH]u.HEH}1LH3nHtHAքtHf H}HuHM:^H1B1B1B1BH}H~BI1HEMt[H}HdBIMt8H}HMHH51HE1LMIeHEL0HEL Lu 1HEMH}A1ALAH}AH}`H}fdH%(H;EuHH[A\A]A^A_]_ef.DUHAWAVAUATSH(IdH%(HEHEHEH=H5KgHH"H}Hu H]H\E1HAH]E1E1E1Mt HML9vPLAL@H}H@IMAH}H@IMHMMIH}H1H5OLMI+dHELD1H5HkHtHAԄt^6H5ߛH`H h)HHu4He(H8H9H51HaHe(HH /)HH:Hke(HH )HH= HHt)H5ZH]1ɅH)H9 H)H=DA` HHt(1 Hi[#)H{9=)u )H=)1(`ÅuDH[A\A]A^A_]Hd(Hd(L0ZHH521L_H=)aE1fff.UHAWAVATSH)H;HL=)d(tI;?tH3d(H;8t ]u^HH=)=;)t9=7)XÅt(M7^YHH51L[A\A^A_]@_[A\A^A_]M7o[D D$YHH51LD _sUHAWAVAUATSHhOL8L(H0AAHt8))))а))))dH%(HEH[*8RIMumIZHD3HuD}DLH@E118WHEt^DHf'L ‹HH'HAwB1Ds7HHLHP N18(5HPSHHqLHP N180SRH AAF=!NsIcHPHMHpHEHEHxDžt0Džp0 ND)HcLpHdD=!NL55)LL:H)H;H5HUHP1\LL܌H;D^ueL@LA;dH%(H;EHhO[A\A]A^A_]H`(HH=Q)[OH`(L0H@AVHH5H1L+\fH`(HH=M'[ATHo`(HH=ϗ)n[/X@UHAWAVATSItu/=p)t&=l)PIăuMt-I̋=Q)LAI=@)LHPAEu>Hc ")1I9}'I22INܾ.LHPA[A\A^A_]H_(HDUHH5×1HD[UHH0dH%(HEH)Hu:H=Hu_XtH}t HEH)H|)HdH %(H;MuH0][Wff.UHAWAVAUATSHhOL(L0H8AAHt8))))а))))dH%(HEH*8dNIMuGiIVHD3HuDnDLH@E11RHEtsDH'L ‹HL'HH=LsHP N108A4`NH AAF=!NWIcHPHPHpHEHEHxDžt0Džp0 ND)HcLpHH(`D=!NH)LHL5)I6HPSLH覈X)P)|A)I>YL@LA;uOdH%(H;EHhO[A\A]A^A_]H\(HH=|)W?Hy\(HH=)xWAHT\(HH=)SWgH/\(L0H@QHH51LW TT@UHAWAVSPE1=*)t)=&)KIǃt=)HcLAEuDH[A^A_]H[(HDQHH5ɓ1HDWfDUHAWAVAUATSPAIHH)8KKIMu.fIHtX;ti=HdRHuWH5)L1HvIMt'LvNHD9sCDLLX5WH5H)Lh^1ۉH[A\A]A^A_]1BH5)L3ՐUHAWAVAUATSHuIH)8kJHuQeH5)HEHH)L I$1HEHtdLMLcA1HEfffff.HML9r#HLL5SuB3t:<=t?@McKAHuH5B)H}aHEH[A\A]A^A_]H= LHH߃}t HtQHHE밐UHAWAVAUATSHHUHIE111E1E1LjjWHAEtyIc-IMtzH]1HEЅt<-HHE111LMEjjHtCLIHH]Љ_AA9v3LoWX 1E1^G 1E1JO6 AEt^E111LHLeMLMtRA 1E1H,L,DH[A\A]A^A_] E1LuHEfĿO fA$@UHAWAVAUATSPIIE111E1E1LjjށHÅHcx,IME111LMAjj螁H1MtdE111E1E1LjjmHAEttIc ,HHE111LIEjj/HttLH|A6W E1% E11E1OWs 1Hy+Lq+DH[A\A]A^A_]ÿE 븿O9 UHAWAVAUATSPIHE1H;MHIILIDH III L*IMtiH@1LLHM M1LOL*AuB E13E11H?HtHAI DH[A\A]A^A_]UHAWAVAUATSPH)8tEIMuW`IH5)L%}L-)IEHE1Ht8E111E1E1~AHcIEHHuAGHcH)HHt]LuIEHHIt=AI@11ME<~HM$DA)McIEJAHufA$Lu )H5)LHH[A\A]A^A_]UHAWAVAUATSHH)8ADIMu$_IH5)L{L-)MuI>Ht(E1f{GF|8HcIHu+YH5)HEHuHM(L 1E1fMcEoK<uH h)AA)AED;=HHuXHH5;)HuH$)D90H )H8IcHHHAMMH )HH)D0H5)Hy}H)H~F1E1LefK<4I4EH )H J1LLeICD9uHm)HJH5d)Hx1H5S)H}rxH[A\A]A^A_]ÐHtUH]Ð?t 1f.@1ffff.UH7D]UHSP#DH[]f.UHAWAVAUATSHEMƉdH<%(H}Љǁt HÁu MAAAt Eut AA A t1EuH}txtj\I|EAElj]ADHEH1IMLPMAfH]E1MDmEu5WE1dH%(H;E1 DHĘ[A\A]A^A_]É|LP%=DDED;IžBMtLnH HHHE11HEHMH]HLnzE11ҋ|jM1ҍBHu9uJ}^ I11IM fALLPnLLM"L=O)I?"L%P)I<$"HH)H;x"III$H[A\A^A_]fUHAWAVAUATSHH)Lc0DLcML HH)HHH)Lc IL IH)L(MJ<H} H )HHEHt]Ls H t)HHtFHLHLL1H}HU1HLuZHV!L5)I>G!L=)I?8!H)H;)!H)HIIH1H[A\A]A^A_]DHHfUHSPH)8EH)7H )H)Hv)?1Hc3HH )HH~1HH)1TfDz@|fDHz@| fD @| fDHz@|fD@|fDHz@|fD@|fDHH9uHt!Hff.TfDHHuH[]ÐUHAWAVATSL5F)I>L=/)I?wL%0)I<$gH()H;XIII$H[A\A^A_]fH)ffffff.H );}JfO?wAсw6HHH)HHHHtH x)H fUHfW1]ÐUHAWAVSPIփu/H_)LcOH[A^A_]ffff.UHAVSHIdH%(HEHha ts1H)HcE1Hf~H )H1f1E1LHI Mff.Hw7HHHhHs"\tf9tffff.HH9‰|fA^MdH %(H;Mu HĐ[A^]g!UHAWAVSHIIdH%(HEHF)8Hu3HDžXHDžP1HXLP1HL)HXHH`t1H)HcE1Hf~|H I)H1f1E1LHI KfHw7HHH`Hs"\tf9tffff.HH9ЉufA^MdH%(H;EuHĘ[A^A_]UHAWAVATSHIIIdH%(HEH)8ZHu@2HDžHHDž@1HHL@1HL (HHLMHPLjt|H)HcE1Hf~}H )H1f1E1LHI Lf.Hw7HHHPHs"\tf9tffff.HH9ЉufA_MAD$W)E)E)E)E)E)p)`)PI$H )HH1Ht+H xHt فwHHH PHHH@uHPL"AEt$At AuW 1EdH%(H;EuHĠ[A\A^A_]fDUHAWAVATSH HIdH%(HEH)8 Hu/HDžHDžE1HL1HL%`HLW)E)E)E)E)E)p)`)PHPLE1u\H)E1~LA@LHc11E1ffff.HHHPHHHCI HH9|W)@)0) )))))Ht*1@tHHHH HHuHLÅt"t uW E1MDdH%(H;EuLH [A\A^A_]UHSPHrH 9)H TfDCH[]UHAWAVATSHIIHdH%(HEH9t/Wt1dH %(H;M HĐ[A\A^A_]Hؽ)AIhHXUt#L8IIIH)HcE1HtHN)LfE111HwGHHHXHs2A\t f9˹u)ALHH @HH9։|ILMIffffff.UHAWAVAUATSPDMEAIHIL9uHH)]9sW1H[A\A]A^A_]LDDH[A\A]A^A_]ffff.UHAWAVAUATSHIIHdH%(HEH_)8Hu+HDžHHDž@E1HHL@1HH!AH ϻ);fAN?сHHHy)HLH{HJƃHC x0HHKHt-HC P01H1A~tH(HL[A^]ܐ[A^]HG ff.HG(ff.HGH1fDUHAWAVATSMIHLc@HCHHHiEM'HCI1[A\A^A_]@GUHAWAVATSIHHPhAD{AHH@pt 1HL|HLALL6)HC L@MtA1LHAHC HH(Ht H{HC H@8HtLHHHPXH!L(D[A\A^A_]ffff.UHAVSHH_o'HHH{HtH{HtH{(t H{(謏Ho'HHC@t HHHC[A^]H5IH@H,L5@UHSPHbHH[]4F@UHHmo'HHt HC]HR5fHGHHQGUHSPHH(o'HHt H{BHH[]EH5f.G fGHDBAA1Ar[D)1ffffff.DDD DDDDH9uEt#H Affff.HAuG fGHUHSPHHHHHHHH{FƃHHH[]UHAWAVATSIHLsLLA>L'fHHHOHHHvHL L9uL.fHHHOHHH6HLːL9u>LL"E1[A\A^A_]UHAWAVAUATSPLEIIIIIA~XHøHCWCLs C(HC8Hl'HHC@ƃHǃH p'HH LfHnH9m'HfHnflƃǃǃǃHHHHAHøHCWCLs C(HC8Hk'HHC@ƃHǃLfHnHol'HfHnflƃǃǃǃHHHHHp'HHHǃHtHHLLPxu HEH1H[A\A]A^A_]UHAWAVAUATSHXLMDEHMHIIdH%(HEHHPIID$1HtHMHHHEHHPHAIuLHu>DuAuH;A|$tyIELELMLLHMPAA{EIEHUE1}AHMH $E1LLMPAH}E8HLP@IIHHHHIM}>HEx0HHuHPAELAOMID$ HHuL}AWHEHIG HH}HuHMHA IIHHHHILAOM1;Ht)ID$HH0LeHEH8A}HAD$1:\AOLeZHMID$0HA(ID$8IEE1}AHMH $E1E1LLHڋMPtA HEH1Le}u9LL@Ht HHLP@dH%(H;EuDHX[A\A]A^A_] UHAWAVAUATSHXLEHMIHdH%(HEHCHuHHEH;H]LE1Lfff.HL9t0H`IIELPHA;OuH8I7o8uMMt>ILAHM<H]L}ILP8HEL0E17199IA{fffff.MvMAFDA;GuI^HI7H7uHEWEH7H]EEAFHAHM<H]L}tTH )HE1HtAHEHMH}HMMPj^HAEuHEHMHE1H]L}7HL >dH%(H;EuDHX[A\A]A^A_] @UHAWAVAUATSHMIIMt$A}XLMHMHuHøHECWCLk C(HC8HRe'HHC@ƃHǃH yi'HH LLHǃfHnHe'HfHnflƃǃǃǃHHHH}HE@@HøHQCWCLk C(HC8H^d'HHC@ƃHǃH h'HH LLHǃfHnHe'HfHnflƃǃǃǃHHHH}HMtA@Hh'HHHAPHHt^HHHuHUuFHEI$IİHUЃzDLEIL$HLHHIT$H1H[A\A]A^A_]ff.MtxLL$HE@H @UHAWAVSHMIHdH%(HEHHMLE u+H}HA<H}tI>1HHP@dH %(H;Mu H[A^A_];ff.UHAWAVAUATSH8LEHUIIdH%(HEHEI$LHuV6tlIE1fDHEJLLHMLEE AEuHH}HHM<At-HEHMJHEII9rLHu9E1PLHu9Et-IGHML$1@I1LMtAI9s$ "A"AD[A\A^A_]f.@UHAWAVAUATSH(HIIIHu H}HUAMMu MMtMt|HuMurHtMthMuHu^MtHtTHuHuJHtHt@A<$\uA|$\uA|$?uID$A|$\LDMtA1HEE1MwE1Mt MtAHtMtMt HtAHtHtMtEu""H([A\A]A^A_]IA<.~<\tt%H'ft k8t[A^]HfUHHdH%(HEHHuPHEHdH %(H;MuH]UHSHHdH%(HEHHuPHEHdH%(H;EuH[][ff.UHSHdH%(HEHHEHHQHEHHt-H=w})B H uHuHH=V}) dH%(H;EuH[]Hfffff.H=})@UHSPHH tH[]HHH[]Hffff.H=|) @UHAWAVSPIHHHCHC S(HK0LC8HC@L{HIIvHLHIFANL{HCKH|)HHK@HH[A^A_]fffff.H|)HHO@H8fffff.UH]Hffff.UHAWAVAUATSH8IdH%(HEI?uJHO|)HL9t,Hq@HHHt)Hp@L9HuHr@H@@IO@HIG@E1DA_(t k8tA_(AE1Ct I HtHH1I?@AI?uCI_ HtHHPHI0Iw8wA_(t 8tEHIH)Eƅ/AHt@H襘HH1HcHHƄ/IWIOL(H)HLLLkALoEt$Hc'tt 8tdH%(H;EukH8[A\A]A^A_]Ew(D3AARA8At=6AH5.2'1H !IƃuLuE1IEt&H't 8tLfffff.HYy)HH9t5Hq@ffff.HHHtHp@H9HuHr@H@@HO@HHG@fff.HGff.HG ff.Hw ff.HG0ff.HG8ff.HG@ff.Hw@ff.H=w)d@UHSPH=w)Hgx)HfHH[@HuH=w)H[]f.UHH=Ux)1 x)Wx)$x)H!x)]fUHH= x)]DUHAWAVATSH=w)w)uuiHw)H'D0E11D5w)AtLu+1Du8uDD=^w) @[1D5Fw)AuSw)Kw)Ew)[A\A^A_]fff.UHSPH=3w)w)tX w)ȉw)v)u H?'1v)u:Hv)Hv)H Hv)H=v)1 H=v)H[]fD1wHv)H av)HD1wHjv)H Av)Htf.@HGWGG G,ffffff.HGG HG WGG(G,HGG HG WGG(G,f.HGG HG WGG(G,f.UHAVSHC,uLs0H{XLiC,[A^]ffff.UHAVSHC,uLs0H{XL)C,[A^]ffff.UHSPHHz)8YHu?HHH[]fffff.UHAWAVAUATSH(IHt L1IAEtM9uu AE I]Ee IE,HEIE0HEIEXHEAɸDEEfffff.uD1 ujfff.E~LmEMILMELmAyHEHEt:u)HM1uHU1H}t4J14tjLmEMI8LMELm1 1H}tH}LHE1HUADžAE,HUЋtB  uHUH}t HUAuH}HuNt1vADžH}=HUбWMuAE H([A\A]A^A_]UHSPHHPx)8HuHt H1UH1ɾ1su HSC  tH9SuC H[]f.UHSPHHt H1H1Su HKC u1 H9Ku C H[]1UHAVSHHow)8HuC ȉC OHCHKCtƒuPufƒuLs0Lt[A^]ǃHXHL[A^]fff.UHAVSHC ȉC WHCHKCff.tƒuPufƒuLs0L7t[A^]ǃHXH(L[A^]fff.HGWGG G(G,UHSPH1tHu)8nHHH[]-ffff.UHAVSHAtHu)8/C ȉC PHCHKC@tƒuPufƒuLs0Lt[A^]ǃHXHL[A^]fff.f.DUHAWAVAUATSHI͉UAIdH%(HEHEHt)8PHu6A21MuLME1HLDMAAH]D0dH%(H;EuHH[A\A]A^A_]Lfff.UHAWAVAUATSHHMLAIdH%(HEW)EHuHt+HH]EEHEHE2}LEHEHEL-m)I}HHn)HE'HMLÅu;EtzH}HHULP(ÅuH}HPH}HP0tDH}Ht HLP@H}Ht HLP@dH%(H;EuFHH[A\A]A^A_]HEI}HHUH$H n)ALMSHEUHAWAVATSHIAAHdH%(HEHEHr)8BHu(LMHHDDM@HEdH %(H;Mu H[A\A^A_]RfUHAWAVATSHIIdH%(HEAAHEH!r)8調HuLMHLDMRHEdH %(H;Mu H[A\A^A_]ff.UHAVSH HdH%(HEHq)8'IMu IHEHEHj)H8HH l)LME1LHP(Åu(H}HHULP(ÅuH}HPH}HtHP0H}Ht HLP@t[1dH%(H;Uu H [A^]UHAWAVSHAHIdH %(HMHEHEH i)H9HH k)LME1LHS(Åu,H}HHULP(ÅuH}H1E@PH}HtHP0H}Ht HLP@dH%(H;Eu H[A^A_]DUHAVSH HdH%(HEHo)8gIMuJIHEHEHh)H8HH k)LME1LHP(Åu%H}HHULP(ÅuH}H1PH}HtHP0H}Ht HLP@t1dH%(H;Uu H [A^]fDUHSPHHo)8艼HuoH۸W2D:1H[]f.DUHAWAVAUATSHI͉UAIdH%(HEHEHn)8HuA21MuLME1HLDMAH]D0dH%(H;EuHH[A\A]A^A_] fff.UHAWAVAUATSHI͉UAIdH%(HEHEHm)8`HuFA21MuLME1HLDMAAH]D0dH%(H;EuHH[A\A]A^A_]\fff.UHAWAVAUATSHXLMMAAIdH%(HEW)EHuMtLLuEEHEHE2MWEEE9{L5f)I>HH@h)HMLELÅuTH}HHuPÅu@HED(EtxH}HHULP(ÅuH}HDPH}HP0tDH}Ht HLP@H}Ht HLP@dH%(H;EuCHX[A\A]A^A_]I>HHUHMH $H g)E1LLMPHEfffff.UHAWAVATSHIAAHdH%(HEHEHk)8"HuLMHHDDMHEdH %(H;Mu H[A\A^A_]2fUHAWAVATSHIAAHdH%(HEHEH k)8蒸HuxLMHHDDM9HEdH %(H;Mu H[A\A^A_]fUHAWAVSPIAHHj)8HuHHDL$Åtɿ1H[A^A_]DUHAWAVATSH0IAHIdH %(HMHEHEWEH ;c)H9HH e)LME1LHS(ÅuqH}HHuPÅu]H}HHULP(ÅuFH}HHuÅu3HE+E*D9| H}HDPMt uEA1H}HtHP0H}Ht HLP@dH%(H;EuH0[A\A^A_]ff.UHSPHHi)8虶HuH۸W2DJ1H[]f.DUHAWAVSHIAHdH%(HEHEHh)8'Hu LEHHDL8ѽHEdH %(H;Mu H[A^A_]d)HD'Hd)Hd)HDH`)H8HHMLELAE-MuSH}HHULP(AE }H}t HLP HPAH}HP0EHg`)H8HHUHMH $E1LME1LHPAEH}HLP@MHEt:E1҃}HML H}H 1}ADEHEHxHHEHEEVHÃu|HEH}AAHUHtH_)H8HLP H}Ht HLP@dH%(H;EuDHh[A\A]A^A_]HHKHUHAWAVATSH HAIdH%(HEHDžHe)8?IMu"IHt0LAHjjHt.HHHDLLLDLWvzEE1脺dH%(H;EuLH [A\A^A_]ff.HHH@־H fff.UHSPHHd)89HuHH$Åt1H[]fUHAVSH HIdH %(HMHEHEH s])H9HH a)LME1LHS(ÅuJH}HH}8u!HHULP(Åu%H}HP(H1HH}HtHP0H}Ht HLP@dH%(H;Eu H [A^]~HÃu'HEH}IH?H觼Hoffffff.UHAWAVSPII~:H2HD{(zA9H[01-H9usINt H[A^A_]Hb)8iHpLRIF I~HH  H(H H HH0HH[A^A_]5諸Hþ HH5'1HzIH迸L藻UHAWAVSHIAdH%(HEHEHb)8蚯HuWMtLEHDL4Åt9HEdH %(H;Mu H[A^A_]褷@UHAWAVAUATSHXLEIAIdH%(HEW)EHEHEHEHEL5Z)I>HH])HMLELÅI>HHUHMH $H ])LMLEPÅu}H}HLP@HE111L4HtPH}HHEHMHHEHE1NHÃusH?EH}jHUHtI>HLP H}Ht HLP@dH%(H;EuHX[A\A]A^A_],HH|HD@UHAWAVATSH IAdH%(HEHDžH_)8rIMuUIĻWMt`LALjj@HtHLLDpzttôHdH %(H;MuH [A\A^A_]&fD111uDUHAWAVATSAIAAt(螱HHHHHHHLd1At[Et8Affff.1HIHt莮H1E7uff.k1Au[A\A^A_]ff1@UHAWAVSHIdH%(HEH}u_H]ؾH蕲HHH諳LHPÅuPH}dH%(H;EunH[A^A_]ÿݳHþHH5'1H謴6谳IǃnDLH5'1Lt?I IL诳H}FL~ILsIH舳L`;ff.UHAVSH HdH%(HEtuH褵%H蚯Lu1҉LHHLͪm,1ɅtFt< u[農HþHYnt=u3HxdH%(H;Eu H [A^]-cHþHsH5T'1H2IHuLMffff.雵ff.HIG(HMHHG0G8}ffff.۴ff.Hfff.G8fff.@w8ff.O(H; uHG0H H;fffff.UHAVSHDs(rA9uH[01HH91[A^]fUHSPHrrC(1HC0H[]H9G(H=HHG0DUHAWAVAUATSH(IA։IdH%(HEH}1RHuLE@LzMDmtE,$1HAHEt6HÅtnLuu~EnE1AEX1۰EE1LuLOu&EtAE`AAE\A nuADdH %(H;MuH([A\A]A^A_]AO@HUHAWAVAUATSH8HIH}u.{t(AAAMԃuE{HEHHMHhHEE1LuH]ffff.IcLdAD$$u Ml$0I$IL$Ht%H$Ml$0I$IL$Ht!H IEH]I $ID$HtHAIEHIL$tcHHaIELHu8X;\}*HI$LXXL舓H]LHusIMI\$HtDH[H}HuHM;}+H`HH`LuH]HLuH]LHuCAMLLAD;{C HCEԄtAAAtH8[A\A]A^A_]H8[A\A]A^A_]sUHfff.112mff.UHAVSHAt1H辚ODHiMbH&iH3H3A)Ai@BH{H{1Hʚ;|Mɚ;H)H5eH6eHOHH HSZ/DHH HDHi6eH6eHHS[A^]fDUHAWAVAUATSH(HUIH}H=)L AAAuH5w=)LHMHHHEH9M$EHHKHHHHL{EԨu.A u'AAAMԃuLhAGP1LLqLL趓LL A$8A;$<})I$HI$A$8A$8 fHXLLHEHH9ELuM0HI01HLHGLI0HuLkM9L}t9IɃw$A~IE$LLEԨt!AAAuQAAAuIpH5g;)LHG/LLL1H([A\A]A^A_]HO H 1H9tHHQHHPHffffff.UHAWAVSPIMw0LIHtHI1HL*HH[A^A_]fff.UHAWAVAUATSPIIIM}LLIHIWAELLpM$L+LLA$A;$}0I$HI$A$A$fHȍLLMLuH[A\A]A^A_]LLH[A\A]A^A_]ffff.E1UHAWAVAUATSHhMĉIIIdH%(HEЍKW?DEtIHLV0I@HL.9LE1HDžEt#HE@H;H4HAuHA9MDAfffff.LMtjI$LP8HLAxA;|}*II$MAxAxfDLHL)HL9rLAAAuH57)LHLDH11fDAI|HPH1ɃB1BT1H9rH1H;rD9EEE1ffffff.K|HPHK|HHPPLK|HJH $HIMNjIL;rEt&HEH;HHAuHA9MoHDHff.LMtfI$LP LLL臾AA;}'IG@I$Mg@AAfL؉LL HH;r~LI@E1LfDK|HPHK|HHPPcHHxK|HIJH$1LLMLx:A>uRK|H1LHLPJKtH裘HH1LIL;LLIDžHHtHH@ȉuH5l4)IpL}HE(dH %(H;Mu)Hh[A\A]A^A_]AL0fAuDUHAWAVATSHIAIHdH%(HEH6)8JHu0Au=H HEHMкHHg/HMиHtZWHI?HÀHEHMкHH-HMиHtHAWIDa AA$1dH %(H;Mu H[A\A^A_]fffff.UHAVSIΉH5)8fHuLu Mu[A^]LH[A^]鮉fffff.UHAWAVAUATSH(LMEIIHdH%(HEHHEHMȺ)LuȸMt11AI~$HDMM/HEL01dH %(H;MuH([A\A]A^A_]UHAWAVAUATSH(LMEHMIHdH%(HEH@HEHMȺw'L}AMt01AI$E11HDMLMHEL8dH%(H;EuDH([A\A]A^A_]2fUHAWAVAUATSH(LEHMHUIIMLLkIE1Hɸt HIIA)ALLu 'fHtWH@IĻMHEID$HEID$I$AAAuH5f0)L许H]Lmt(AAAMЃu'ELkLL_xtHLL WLmȋEЄt!AAAuxAAAu"MpH5/)L覻LLmj#MtRLL躷AA;}$II$MAALLLCH([A\A]A^A_]HHtL LL1۸XHELLAHEPLmH]HELLE11LHfUHAVSIHAA~HcH _LI8HOAdžI`LAH蝊1D ODRDcHHt;HALqHHHHQH HL>1[A^]UHAWAVATSHdH%(HEH]-)L EE1L}1ffff.A|$$LnHu胅8 uÃtHtAOdH%(H;EuDH[A\A^A_]̅fff.UHAWAVATSHIdH%(HE@u1L}AOA~$LψHu8 uÃct HuE1dH%(H;EuDH[A\A^A_]0H@UHAWAVAUATSH(IIMoLLjIAHIHELuIHEE1LmL}ffffff.HEWLL۷MLm@L;H{SLLHM;})HHHH8LmALeLLbMLuLLmL{I$HMG1EADOLLDH([A\A]A^A_]ff.UHAVSHdH%(HEL5*)1AOH=*)^H='+)R@_HøHtSH3HEH}zH}tgHH { C$H0*)HH*)HA1#AH *)HH ))HdH %(H;MujH[A^]Ãt 3{}+{A{$t {C$H))HH))HHHPxHs}ngUHAVSHIdH%(HEHEH}yH}tHH A~ AF$t yz}qzdH %(H;Mu H[A^]ށfffff.UHSPH{$1t(z1ɃOEC$H[]ffff.UHAWAVAUATSHHHH+)8yHuHEHpHEA1HELe׉E HHuADOHDLM xEDmAwAEs2HEHHU uLuAtAHHUtEELmAAAuLH5')ϯAAAu^AV,ULLmLLL(~AAAu׬AAA1AHzHJcHHErLmAAAuLH5&)AAAu}AF EIV8I~0G$H 4")HxdHUt ELm!GPEHEHPLmL輌HUHLHEHpLUMAAAu衫AAALH5%)ұH}d{$HEALvC$;H11E1E1H}H HEPjj褈H H}H|H]L8LǃH`HvL襁PUHAWAVSPIIH5y%)L17ffffff.HIG(H{(HLP@H{L{HxI_(HuH5(%)LH[A^A_]馰fDHY$)HHtUH]1UHAWAVAUATSH(MIHIdH%(HEHUϹHx L}E1AD}AvAOuAGw9HEHULujAHEIEAt0Au*HULu3EHMAD;dH%(H;EuDH([A\A]A^A_]AO9|fUHAWAVAUATSH8IHdH%(HEH5#)LmDc0HS(H~H]LuDe1HELmE1MII$HEA\$Lz9tMu{IAtՃ \1xKAAD$ 1ɃAL$)ĘtAD$ AD$AD$AD$ HUIHMI0HA8I$La8HEHEH6IM<$Et$@DLyD9tK.zHËtԃ 1DwAD$ 1ɃAL$(fĘtAD$ AD$AD$AD$ LHMHQ(I0HA8I$La8HEHEH=*ff.HU f.LHM1H5!)L}L.LmEAAAuH5 )L&H5_!)LHEHX8HtLHDeHHy tXHHuEHEH5!)L蟬E1cDeZH@8H5 )LwDeH5 )L_AAAuH5 )L_HEHX8MH@8HtlLuL;{ tKHC0Hff.HC0@H{G,L"yH{(HLP@H{LvHqsMLuH5 )L}L薫Et!AAAuAAAuH5+)IpLE1Ku6HH tHIO(AO0H{(HLP@H{LnHkH5u)LDH[A\A]A^A_]ff.UHAWAVAUATSHIIAdH%(HELeDDL`oD9txIAuHUЋLuȃ IIƠfH^IL9tHHKHHHLkM8LfOu5ADžI`L\ALagD ODDEH{RwHyI|HEDH[A\A]A^A_]D1ɸt@u1ɸf.fUHAWAVAUATSPIAIMl$HuHLeI$1HtE~Ic1IHHHtH9|I$A$)A$H}LD9}BHcMcffffff.@?HtW@0@ @IHL9|ӅS؃1ɃrS)1H5&HWIHcMcffffff.0=HtW@ @IHL9|ׅS؃1Ƀrg)1H5+&Hffffff.IMLM2LH(H8HL<$L)AHHDP0tuEWCLALr]IHMLE1LL&SÅuH(H8HHULLMPH}Ht HLP@1dH%(H;UuH[A\A]A^A_]3JUHAVSH`IdH%(HE 9u LxH 11GHH fH(HH0HHHHHHHHHhHHpHHxHHHHHHHHHHAV0H@L2dH%(H;EuH`[A^]Hffff.HP0ADƁHu;HwxHHHfp8pDHHDƁHuiHwhHHwpHHHHH@xG(G8GHGXHHDH=HffH HNH f HNH fHNH F  HA00HA@@HAPPHA``HAppHHHHHHHHHHH  H00H@@HPPH``HppHHA@I@u9HHSXPFuH @r| EXPFu u `0ÃⷉP0HH@H@fff.UHAWAVSPHIAHt-sD9u AL9u(AC0t9DH,E1Ds01HfH:HcHH9v HHHH51HT/HHH:/H1\6LI^LHMuLLH9v HHHHI9Lu HDž1IgLIMHI9uHHHLF7LHLH9Ht HDžHZHHDžMHADHHuHHHHDžw HDž@f./HHHHH-H4@H(8 *HuDH={aH{IHMIA}:Mmt:L0Ht HHL-HcH HHH B (LJ|:LHMuLLH9H v HHHHHIHI9Lu HDž1IfLR HHHHjHI9Hu.HHHH4HHHHHLHHDžLH3HL/tHH5 .+HHHv+H12HL  H:+kH++__HHH9t)W ";HHH9t3 HDžHH1HHH9t AE1L1L1H1۾1AALjޥHII1HuH@E1L @E=MZu~u̅tw111Ltd1HHE1Lt@u4PEu(=u= u 1ۃL*-t_HAOE1t~H5+He)E1t_H5uHF)E1HL/t#=@AE1E1HHtHH1H(HHtHH@@H(HHtHH@@H(EtLHHtH(H8HH@ H(HHtH(H8HH@ H(MtL9(HXHt*T11HH@@HH(HHHt*D10HH@@HH(H8Ht*410HH@@HH(MtI}'L'HHH9tdH%(H;E6DH[A\A]A^A_]H1ۅAA311E1E1Ljj]HHE1HH(8y#Hu_>HDH III L!IE1MtVHGrLL0E1H*hLL/E1Ll&IMMHtLL0E1FHLLI/E1)HbtLL,/E1 HgLL/E1L%IH5<'LIMQMH<'MLHWIM-A$"M9v AD$\tBfA|$Md$"LVIMAD$\tfA<$IuED HHH9t 6D HDžHHE1HHLI9tHDžLHKLA11LMjj [HmE/E1EMA*tAEnIEuE1AEnIEtNA*uDA"uM9vA~\tA~Mvt."L'IMtHA~\tA>uE1Mu /Mt*E1AAEnIA;*uEhA|$HIMELtqAD$HLIAMtL91IA"t\tuIwA"LDAH97̉H1HAuLHH L"E1H]E1Hx;t1ɸ@<u<uHIƀ;Lt21LH1Hfƀ<uH<IuHH(H;HHH(H`LH(AE'H;HH@HHHH (LAH(SHAHDžEHHH(HCAt/H"H4DHHH@HLH(AE8o(AEt9AAOADe^AH(LL"(1L##0:ƅHfDHH$8t-DHD8HHHH(HDžHE(@=tfHXHH@@H(HDžXHHHH@@H(HDžHH8HH@@H(HDž8HE0HHHHHDx@E1HuSHvn:uQDH} HtHE(@=T1u#:0$!DDDu D4DuI|+D#DMHuH(HLLL"ECA?= HDHHHH9tHdDH\DHHHH9t_Hg&H/Dffffff.UHAWAVAUATSPEIIIHH(8eHuK5HHHLLMu(u uuAVH0Åt!1H[A\A]A^A_]fffff.UHAWAVATSH IIHIdH %(HMHEHEHEH a(H9HH 4(LME1LHS(ÅuqH}HHMLE1LPÅuTHExtE811%t0HEAH}H1LHEHEIHE1H}Ht H1LH}Ht HLP@dH%(H;EuH [A\A^A_]=!ffff.UHAWAVSHIIdH%(HEH(8Hu3WMtHUHMHL[Åt#@ 1dH %(H;Mu,H[A^A_]Ã}u EAA fff.UHAWAVAUATSH8IIHIdH %(HMHEH (H9HH *(LME1LHS(AE'H}HHMLELPAHExuA$@AH}H1LeL}L}ffff.LHM9tdE1L1L  LH'dH111LHHtUE1H11pIMt/HpuLtE1AHL HE1dH%(H;EuDH[A^A_]fUHAWAVSHhIdH%(HEMIHYcH]@1HH5HIMtnHEHEH}Hu L HtMH})GHxH5bHU1u$H}L+HEI dH%(H;Eu Hh[A^A_]fUHAWAVSH(IAHdH%(HEHDžHDH<=wEHbHPt#LH1HDMNdH%(H;EuH([A^A_]fff.UHAWAVSHMIdH%(HEH *';1HP1IMtEHiPʚ;HiXHH ףp= ףHHHHH?HHAH AWMt_Hi`ʚ;HihHH ףp= ףHHHHH?HHAH AV+1 OdH%(H;EuHĘ[A^A_]fUHAWAVSH(HdH%(HEHEH(8IMu*IHH9tmH(H8HH =(E1LME1LHP(uLH}HE1HMLE1LPuHED0H}H1LH}HLP@ HI('D0dH%(H;EuDH([A^A_]UHAWAVAUATSHHdH%(HEЃ=(u#H@`(E1 E1H@1HiPH(LHLXLi@E1H01KH(LAKMTEHi0H8H HtI6Ãt=uI>H٭(HLV "amaY11E11Hu1҉ dH%(H;Eu H[A^] DUH'bffff.UHAWAVSPE1"AE1H~HH<(HtK詔HHu7H=˳(1|AEtH(xHH E1EADH[A^A_]DUHSPH={( u^H(.HHuVH(H(1HHuBH=$(uJH[]H'HH=QBAH'HH=R)H'HH=6RAH'HH=`RD d@UHHm(HHg(H=²(=1]ÐUHAWAVAUATSPHIHts/Hj6IfAHLcK|-IĸMtMLLH?tLCO,fA/H߲(H;'L#HŲ(H;L31H[A\A]A^A_]ÐUHAWAVSHXIdH%(HEHEW)EHEHULÅL=(I?HHULP I?HH(HMLELÅH}HHMLELPÅusH'HMAH}HLI?HHUH #(H $H (LMALPHEu$I?HHULP 1H}Ht HLP@dH%(H;Eu HX[A^A_]DUHAVSH(8;HHuHL5(HL6H"(H8jH (H8[HL[A^]:fff.UHAWAVSPHIL=1(L6H(HHKHH(LLH[A^A_]2:fUHAVSHIH5(G6Hh(HHt>H9HHt2ffffff.HHHtHHH9uHJH1(H H5(L[A^]9H (fDUH1tHZ(8HHuHH54(]5fDUH1tH(8HHuHH5(]&9fDUHSPUH(1 t=9t11kt,H(~H M(1HHtH[]&H[]ffffff.UHSPHHtHHHHuH[]fUHSPHHtuHH61H[]fDUHAWAVAUATSHIHLHN<0Mu HIL9v LIrsHEHuI9Lu Hǃ1IweHuIMI9uHHLH*LLHEHHuHELHǃMIILLHHH[A\A]A^A_]ÿHH9tHǃH1f.UHAWAVSHHdH%(HEH(8IMuINj{(Hs0K(LC0HLH1K(LC0HKL1L11LKHC@HE1H11!HC8HLSHC HH ~11E1LIPARj H AEuHHI4E"wSAH GHcHA{s"wFAH GHcHA{FAd>AW6A.A &AAWAA AdH%(H;EuDH[A^A_]f.fUHSPHu8H{8t+"w*HnGHc H{/H>u#'W d{tH[]ÉCHCHS11H[]f.DUHSH8dH%(HE_(ƅHDžHHs=wLHIH=Pt*LL HH1~HHdH %(H;Mu H8[]UHAWAVAUATSHHdH%(HEE1{A{(HuAWE1HtyH]IMMl$LHþ/H`HH@uHH5H8 tM$$E1MuH]It$H]HCHSE1LH{@Mtff.ILHIudH%(H;EuDH[A\A]A^A_]H5`HHuuH@JHHHf.UHSHHdH%(HEH{8t6K(LC0H GH1H{8HH{@t6K(LC0HFH1H{@HH{ Ht|dH%(H;Eu H[]HHHfDUHAVSH HdH%(HEHEHEHHMLEHHPueHEL0HH}HHAu3ILH?(1HGH&(IFL5(HHdH%(H;Eu H [A^]fD1ffff.UHH=Ŧ(H5.1uH¦(]ffff.UHAVSHL5(A>H1 1$HYA>1[A^]AfDHQ(H,(8DUHAWAVSPH='(1FH(HHCH(H=(GHY&HHHCCCƃƃǃHǃǃfǃPƃRWǃXƃhLpLѐH HZ&HH Hǃ(HH0ǃ`ǃ%HX&HHHY&HHH1HX&HHWH!Y&HHH1{H=( F I1M}H#X&HIIFAFAFAƆAƆAdžIdžAdžfAdžPAƆRWAAdžAAAXAƆhIpH4I HfX&HI Idž(HI0Adž`Adž$HUW&HIH[X&HII1H^W&HIWAHW&HILH1LHH[A^A_]IHIL$Lfff.UHAWAVAUATSH(IdH%(HEHx(8IMu IHE1L9 AtuHx(H8HH #(E1LME1LLP(ÅuHH}H1HMLE1LPAEtH}HLP@E1DH}H1LLmȅt'E1Au&HHt H{PtH HH ) HpH[A^]6wIH  HpHwLUHSPHbHH[]T@UHAVSH=(==b(~(L5(Hv(fDLH=:(H=U([A^]fff.UHSPH=3(11zuH=G(1XtH= (OH[]f.UHAVSHPdH%(HESHLuL4HLHuHULLHEHEdH %(H;Mu HP[A^]Lfff.UHAVSHPdH%(HEHLuLHLIHuHULyLHEdH %(H;Mu HP[A^]UHAWAVSHXHdH%(HEHXHuFRIL}L3LLHuHULLHEHEHXdH %(H;Mu HX[A^A_]BfUHAWAVSHXHdH%(HEH`HuBIL}LLL8HuHULhLHEH`dH %(H;Mu HX[A^A_]fDUHAWAVSHXdH%(HEH(8(HHu HHXHuFIL}LLLHuHULLHEHEHXdH %(H;Mu HX[A^A_]UHAWAVSHXdH%(HEH(8xHHu[HH`HuBgIL}LHLLHuHUL L%HEH`dH %(H;Mu HX[A^A_][ff.Hц(H8Hφ(H0ff.UHAWAVAUATSH(HdH%(HEH(8IMuIHH9tcH&(H8HH ц(E1LME1LHP(Åu>H}H1HMLE1LPAEtsH}HLP@E1DE1M1E1uL-uAMt ILLP@dH%(H;Eu-DH([A\A]A^A_]HEL(H}H1LL}@UHH(8Ht]]q1f.1f.UHAWAVATSH IdH%(HEM8LrALJ,L?H}оAEA4L+ELe}кLOHu 8tHu1ۀ}*AODDDEEuLALJ,L}E}=dH%(H;EuDH [A\A^A_]fH8t@H8D@UHAWAVSH(IdH%(HEEHe(8IMuIHEHEHMLE1LLÅuI HUHMLH}Ht HLP@tOEEdH %(H;Mu H([A^A_]ffff.UHAWAVSHIIdH%(HEHEHEHMLE1ÅuI HULL5H}Ht HLP@dH%(H;Eu H[A^A_]UHAWAVAUATSPIHAAKHMH8HM8!fff.HxHLuMpLoAxtmAA4tu UH5^!A4H5=!t4t߃u]t΃ uLLnLHbADž4L|nLHHEE10LUnL}HuAOHEADH[A\A]A^A_]ff.UHAWAVSPIHH8HAM8HCHLuIpLH[A^A_]mfDUHAVSHIHpmH8I8[A^]ff.UHH81Ʌ]DHHUHSPHHHHtH[]fff.HhUHSPHHhHtH[]fff.UHSPHH{1uC@H[]f.UHAWAVSPHL{H11LAOu(H{h11t L ǃE1DH[A^A_]UHSPHHp3&HH{@t H{tH{H(HhHH[]H[]ffffff.UHSPHH3&HH{@t H{ZtH{HH{hHH[]UHSP1H~(fff.HHscKHHsBKHHs7KHHs,HH@r@u+贎H HHH Hc~(.H[]DUHAVS@rWh13H-}(8IMuIqI[A^]fff.UHAVSI@rW1'H|(8SHu9L[A^]DUHSP@rW蹍1UH|(HHt$ffffff.HDŽH@HuHHH!:}(H[]fUHH|(8OE]fG0tfHHHHHHGxHLLLLLLLLG0t%HT$HO8H$WDHT$HWBG0tG0t*!HWH!HWP!HWX!HW`!HWh!HWpHd$G0UHd$G0t*HWH#HWP#HWX#HW`#HWh#HWp#G0tG0@}um e0]@UPM`Epc=c5c-c%ccc cG0t0fGBfD$ HHD$GDD$fG8fD$HH$G0tfHHHHHGxHLLLLLLLLHtHHd$0]ÐfULLLLHHHHPHfDUHAWAVAUATSHHHHdH%(HELAtH8HcHb&HHcHW&INHHHQHSxHQHALyLaLLlLLLHHHcHHHHHH1LdH%(H;EuH[A\A]A^A_]f.PtHHt@Fu LJLJffffff.fu'HH#HHHGHffff.1f.1HHc HHǐjHLjaHǘXHRHpLHhFHx@HǠ7H(1H0+H8%H@HHHPHX H`HǨHfff.UHSPHHH{(H(ZHHfu HGH11Zf. wHHc HHpKWHB1HǠ+Hǰ"HH H0HHWHBHt HB11f. fUHAWAVSPAIHHn)8HH&HHCHLǃIG(IHK@HCHIHKPHCXIHK`HChLHHKpHCxIOpHHǃIOhHHǃIOxHHǃIHHǃHHǃIG0HHǃIG8HHǃIG@HHǃIGHHHǃIGPHHǃIGXH Hǃ(IG`H0Hǃ8IǨL@HǃHHSLH{1LWHHaHHtdHSLH{1WxPǃHǃHC PEA$DPfǃfǃC81H[A^A_]ff.tum1fUHHAdH%(HEL Ic LAAESHHcHD(D O81E{HG4LO`HwhLOpHwxIIHLHLHLHLHzLHjLHZLHJLH:L H(*L0H8EtH HOL@HHHI1EtUHHEHtfLHHUuNWLDO8tHcHD(H171ɅHHt@HLHHtu Ht(H21 LH1W dH %(H;MuH]LH1Wffff.f.UHAWAVAUATSH8IdH%(HEAdžÅyux8Iu IF1dH%(H;EH8[A\A]A^A_]IFHEMnAdžL~LE1LmI~IMI~IvHU1AWMI~IvHHU1AWxqHH#EH%hH9uTHE%H9uAHI#H IIFI@IdžHHIFYIF@HEMMtIu Ht0Lmb1H}&MI~HU1DW MI~HU1LWAEtLm1HEMAHEMI~HU1LWAEx HMIFH)rH@s IMHM IF1HME1HI#HH IHIFMI1H}=MWHCHEI@IdžHAPDLmE1It}M~I@HtIHuHt!I76I10MI~1LW MI~1LWAEx%I7L9AHEI9FD\f.fUHAVSHC*H{0HHCPH9tK,HcH H{@Ht$HPH9tK,HHiH{HHt"HP^H9tK,HcHK*AHcH"AE1HC0HuHC0K*AIcHi"AE1HC@HuHC@K*HcH"AE1?HHKHHu HCH1ɸH{0H{@HC*fC,fC(u*HCPHC0HPHC@HP^HKHC(fAHa K*|3HKHHHHfDHd K*9|1t0HS011fff.HcfrK*9|[A^]ffffff.UHAWAVAUATSHIdH%(HEI|Jy7I]HK@1҅AfLcXHH uH=2&t LXCD;u Hu!L 1҅ACDMEfAf~0HHHD tL9uHHi޸qLI?)H@HH1Hw H @4HHAEHIHE1ELHHs@HHE1HCD/aH HcHLHW):KD H'HHKD 1Hw H ?4ELHH HDŽ KD H11D0HHHH H@xHHHLAE?LHLHHHHE1Hw H -?4tIHDŽKD H110HHHH H@xMIHHHL;AEJ5tqHHHHE1Hw H q>4HJDŽ5CHIHDŽE1HEyBHHJDŽ5E1HEJDŽ5IIHH;HHCIHHt @1HAt]HD HuHt'HAH=LH{H1W LH{H1WAExDAHHCH;uAHH9CtPt HL&EdH%(H;EuDHX[A\A]A^A_]zf.UHAWAVATSHHdH%(HE؊PLL{LXWxhXHǃLH{LLu"LH{LLFAyO Aw>PʈPAx&HLHSHXHAPu.HHt1u(H=)"HǃHH{LPExH`HC E1dH%(H;EuDHĐ[A\A^A_]DUHAWAVSH(IIHdH%(HEAHLpHHHHMHXHMHEPI)LHLUHULEHLLPAR$HAHuHt+L=)ffff.HH]LHHuDD!udH %(H;Mu H([A^A_]UHAWAVAUATSHH IHdH%(HEЊPLL{LXWxhXHǃLH{LLvu%LH{LLAy APʈPAL(HLHD`FAAAHHPHnAHHHHHLXL@HDž8EL`M9L0LHL9HHPH@LLHIPH8PHAEL@M9s1H HL(AEKL@ML`M9LsLHL9HdH8HL0L>L8H=)ZMLuL@L`DPAPu.HHt1u(H=) HǃHH{LP$DPdH%(H;EDHĸ[A\A]A^A_]AsAhL0M9XH HL(A4H8HL0L>L8H=);MLuYfff.UHAWAVATSH IIdH%(HE1xLAƄ$AƄ$WA$AƄ$AƄ$A$AƄ$AƄ$A$AƄ$AƄ$A$AƄ$AƄ$A$(AƄ$AƄ$A$8AƄ$AƄ$A$HAƄ$AƄ$A$XAƄ$AƄ$A$hAƄ$IDŽ$xIHH0I$HHMHEHELHLUHULEHLLPARHAHuHt,L=)fffff.HH]LQHHuExI$IL;E1dH%(H;EuDH [A\A^A_]4@UHAWAVAUATSHHLMMIIHuE1 H}u HGH H&&1HMH8H}HEM9<$LELMLUL]HEXIHEE1EIL9u1HAI?E1HEׅt@@ƀ@@.H={Hc4HE1AAH11fff.HI߃HH HxAJDHEH$H}HuLLEMLL]ILMLEAAHAHAHIIB I$E1b11fffff.0HIHH H@xAH#11ffffff.HI߃HH Hx11ff.0HIHH H@xAHADAID0IE111ffff.0HIHH H@xAHSAƄ>11@0HIHH H@xAHAƄIDŽE111f0HIHH H@xAH11ffffff.HI߃HH HxAƄSLM+H=(L]IHLL(I;HHuLL]E11I3AH.HH}LHEH0HHMHH=(L]ILMLEE111ɐ0HIHH H@xAH11ffffff.HI߃HH HxAƁIpAƁIxE1^11f.0HIHH H@xAH#AƁIpE1 110HIHH H@xAƁIxE1AƁIpI11fD0HIHH H@x11f.0HIHH H@xAHSAƄII11ff.0HIHH H@x+11f.0HIHH H@xAH11ffffff.HI߃HH HxHHE1@IDH?IGH Ir(AƄIj11fD0HIHH H@xAH311ffffff.HI߃HH HxHHE1@IDH?IGH AƁIpIr(AƁIx11f0HIHH H@xHHE1@@IDH?IGH IR(AƁIxZ11fD0HIHH H@xAH#AƄII11ff.0HIHH H@xHIE1A11fD0HIHH H@xIQE1110HIHH H@xAHwg11HI߃HH HxHIr(AƄIE1&IR I$E1M+ALELMI@M9<$v1EANHH[A\A]A^A_]f.@AVSALAPt=ADрɀ H5Hc HI3IKIILIILI1L1D7HH:DHH HExTIKA3GIKA3>1L1DD7HH:DHH HExIKI3IKIc3H HtDуp/t&u.LI0t @uI0Ip EyH6I11[A^UHAWAVAUATSH8LMDEHMHHuIdH%(HEЋC(HCH0tHH&L0HAHEHA HI( HK@1HUL(IL#!LIL{8{(LuHsHQ&L;2MHM)1LL$>IC9TIL$HNLNL9rMKTHty1LEMHcJMDLHMHULLLuLDMuPHx8I{(uLIM~IF( H;Ew1HEI9FGdH %(H;MuH8[A\A]A^A_] UHAWAVAUATSHIdH%(HEлHAB1HDBLJL:MHIJ1E1E1E1ffff.1Ptdt6uAHqLI9rHy(HI9LBHq L9LG!f.Hff.LDH8HyM(HtH[LLLDHLIz?uH@HuH111H@HpH81E1HDΤHH0HHGHHHk?ELF_UKH5H0 1HtHH HHHH0H8HHHHLƅ@ƅAƅBƅCHDH@DILMt4IEJD fHHHHt!HuHHB8HJ8HB8HB8HB8HIA ;LDHQ&H8HMLHKH0H &&H9KHH0L(HHLMjHI݉ÅHڶ&H8AMHH0L HLjHHHÅ:H&A};unA@HIFHA(IF(HA0HBHAHH0HA`HH# HAXLiPZA}u HDž A}H8L(H HQHL@HHHtaM9s\E1LE1HHH@MjjHHx#L99wL9yw=IL;s H@L9r1dH%(H;EugH[A\A]A^A_]Ãt7H@H@HHMDjjHxH@袜ffff.UHAWAVAUATSHMAIHIdH%(HEWEEEExhXH8(HEHL D(DžXEH=HB~W1,uLXtH0LHLEMu}tHULHLEMdH %(H;MuH[A\A]A^A_]Zf.f.DUHH=(1H=(H1ֹ1]fUHAWAVAUATSHHLAB8E1Ht/Iz I\:E11{uH9KtHH8H9|H+IHNHA:ELFAzAzLMIZ(LHEJHuL]MLuH;EADCMIM9]HEfDX:fDHH芖A?A-H8LLHLifA/LH0LLHމÃL蝕L%H/.debug/I ADLH0袒LLBÃ,ueu`Hb/debugHHCH/usr/libHHH8QH詏f/HH04HLÃt>HH JAHdH%(H;Eu+DHe[A\A]A^A_]HI$H ID$UHAWAVAUATSHIH_1HL?1A?ELF1A1AIO(AW:1MIAw<HcHH9AG>HcHH 1H9wpIL71LHHUt]IL7 H9wSAGfffff.ˉff.ff.ff.UHHt&)`)p)U)])e)m)u)}LXLPHHH@dH%(HE1@@tHH0HEHEHEE0EHcMH(wHHEIM HEHHHM1dH %(H;Mu H]~fffff.黌ff.HtH1Ƀz H1@UHAWAVAUATSPIAIILDL蒂HHu0LP8LL|=H J (H A< u*HHH A< uA A HHd=fL蘉LDLHu Lmu识8tH[A\A]A^A_]fDUHAVSIHIˉH9sAF[A^]fUHAVSMH螉H9sA[A^]ffff.H1HtH8Hcf.1Ht?t1f|H@u@1Htf?t1f|GH@uȀwHHc H@@u1øøf.@1;Cfffff.UHH dH%(HE}HEH5I&LH}i蟁H1HtHAdH %(H;MuH ]臅UHAWAVSPHIHK1tIHHH!aIǸMt&H3S HLM>HCAFH AF 1H[A^A_]fH?UHAVSHIdH%(HEHEmÅ1A~0t1AdžIHULÅHEHt|IN I@ɻtlAuOHtXHx(IHu=FI 2AƆIF x@`HIHtIF H@11(|dH%(H;Eu H[A^]fUHAWAVAUATSHIIIX}HAHLeL}WC@C0C CHCPM} ACHC@AE0t7M}(CDLDdL}HCHtSHLL#M} AHt|HC Ht*A@Ht|HC(HtHEHHEHE1KH{ HtHC8HtH{ }H{(Ht}H{Ht}H}蓯莯DH[A\A]A^A_]fff.UHAWAVATSIHǃLOMzu"AL$DtIt$HH2JJ HL-kM|$ MtLELgAAsuHBHHHJHHHBH@)0Hc H(wHHBI HBHHHJD8Mv<wwH HcHH +-H-H1EAA‹+DžH HH 9IHɋ  H@HHB(0 DždH -t 1҃+A1EE1  IcHHL{AE1H -t 1҃+DAu1EtE1 ALDMMDAH +1{^HCHKHHEt DžW)`)P{M8]H *Hƅ[ @]1HHAALM5MD1HH AEE H Ѓ LLDH1HIHH9"HD2I H HH9Hu61HIL$ HpI9t LLJLIHuF=MHt;AIL ÃzAAH ALH+tQfDž,?.H,H.LXL,HfHHHHHH 2H H HH L. 1L; tHHLp cHHLH +teHf. H xDžxH t L10H D+H HHBHD HHpHHiHDžLHAH ˃Ѓ LD+DH1IIHD9KD:K A\H9H L1HW L$6HpHH9tLbALIHHuF% HLAHM L IHHpHhDžH LHHމ˃I LD+LL MT:HAIHMLHjH@H IHHpHBhDžAGAEL Ã+-LD+LH HD-HHH9 1HL; H4 HpH9HH?HHHLD+$ H LHHHLLD+HALL OT:HDELHHD)IIHLHLfAŻDžoDEtLAD+1D+LLD+L1H.HALH 1D+DLD LfDA߄ H w EKL$BtFA_ΰt5LMHAAͰH ADtLAD7xHfff.A߄MHL A߉IcHHAlj߃ BȃHcHTHHH A\$ʰѺD+iH ʃЃoHRHcLD LA߄& H 7HEN$A_ϰtLD+DwADLHAMAALDD+DH D[HALH 1D+DLLD A߄Z H w.EHHHBHtLA8TuLA@t E1Ixt$?LLAADE˃s HAAuUL`@~LA@tIxt0L1LAt"AAAuEL`EEnaELffff.AM1HHTq6LøA@t IxL DIA@AtIxtLOLt AAuL%=LA8TuSA@t E1Ixt$?LLAADE˃sAfffff.IAAD$ADL5AL DLpLhA@L DLpLt Ix0E*MA]LDIA@AtIxtLLt AAuP;A8TLA@t E1Ixt$?LLAADE˃oL5ȺL DMLa(HHO@{HH ݺHDхHHtH;t HÅuH+sEDDž|ȃttExoAfffff.E~VA@tIxt7 LLIDL ƶLAAAuAAzHOHAHGH 1HH3H(HOH@L)PH`hHGHHHOHHt+HPHHtEDžHNH 1H`Dž|HDLL DLpLc~4u HITA@tIxtbLMMHMML5kL DLAǃDDDžAfDE0ALAHOHAHGHH(wrHHO@p(wsHOH@D)%fDžHGHHHOLc(HGHHHOL(zHOHAHGD)fHOHAHGD)QXw HBL1 DHcF1AAX/ADEt,At&(wHG7AdH%(H;EuDHĈ[A\A]A^A_]7f.UHAWAVAUATSHIIdH%(HEMMH0fA]E1fH^HH`DžT1HDž<1HHE1DžtHff.8}Df.ALAAt,A8AOuALffffff.A]Io8uE1fu'fffff.%AE1E1E1E11H A |HILHsCu ȃЃ v؃MHcHIAICEH tHcHAIVAIAAICluH.AAIgLkC2VIC4u@HAI1H3L苼HىH9AIiA1HEɸHxuIH0HBH)Hc H(wHHBI HBHHHJHHxD.EuADStAHD HnHDDDD@u)LDA@DHLAAE8HHLZ1HALEҋDDu EBt1LA0AsLtH{HH0HB(Hc H(w=HHBI ;LL袺AAK5uHBHHHJHHxHBH)Hc H(wHHBI HBHHHJ0HH@wmH HcHH++-HHf-1EAAEXDžHHAH96H`ɋAHRdHH-t 1҃+hAYE1EME1 IcH`HHAƅ@1HH-t 1҃+hAuE1EtE1q ALLE襸EIDLHEXLkCHK^LEt Dž@HHHHHu& E1HHDž<HE11 H)H{5AE]$IC fA]1HAALL買ID 1HAEE E1HtLHHHvHHHDHE1HDHHHÃЃ &AHD9HHJL1HHH:fBrHH9HLE1H?H9LH4HHH9t( H#HHHHEH HHHHHHHH(3DžtIHIHHL DžhE11 LALӵL DžhHE1H0uaL覵 ɃxuAL艵HE1DEɸxH LAE 1D HH0HB(HHLELHHMfDž.d.H0H赶H9AGELL蚴HM}HfBiHHL9LE1H?H9HH4HH9vH HHHHLLHLLL6HL!LHWE1LDLAE]uLIUfEt -u2]u ; ;JfA9DfBfABfff.H< @< vf9vI1LfA]IoH{LDH@L@LxDu3HLxILMLLxMDAHcHHEHMHHHfAIHLxEHt~HDAcAsE~D)LHJH $AIÃu(LHDL許Ac$HLxADŽILjHu~ED)L:HcAAIÃuoEfD)LHAct?A{HHHH0AIÃuAcDt\Ast;A{HcHH 1@0r kƃ wH>HPtDAILuAALxD!DHALxLHHX LI$I9sMHH~)HcЅLx~ H;+LHH@,H@LxLH.)HI LOHHHH)ƋDLH-HHHLE1L;x tH`HLCTHcH`HLHXtkHxf HHxvAxHHt L010HL{Hx MHHLMHHLIt*LLDžtLLMDHHHt DMLhHHHDH(DHXE1D؉HDHЃ HXD9HJD8HH(H HfByHH9LE1H?H9 HH4HHH9t(lH HHHHBHHH HHHHH(DžtIHDnHhLH諫ILAAoHDEtLAL1LLDLHXEDE1HALH1LDD ҅ эVHcffffff.DHt EKL4BtCDkΰt2HLAAϰHAAtLA݉/XxLHf.DaHH{HIA݉ %IAŃAA DBDEIcNt0LHLHDnɰDVH@փHoLH\ ҅ эVHcff.DaH|7hEN4DkϰtLLLDDH7HLAHLAAALɨDDLDHA HAL>H1LDDL ҅ эVHcDgHt EKLBt:Dkΰt)HAϰHAtLA݉@XxHfff.DHHuMHHDDY"MIAЁA BDEHcNTLHHLEnɰDUH@փHoH ҅ эVHcDH7eENDkϰtLHDDHMSLLAEHAωLMA0MDDLDHA$HhLH؄LEL1HhLH؄IDE1tH`H-TH`HEHxtH@tfLOl=EHDHH:HHHˋHALhHHEH euztvIUHfBoeH9HHukLE1H?H9IH4HH9tGVHMHLgHLHRLHNH\HHrMMHHL DžtLILHDnHDxL菣+H-HLfDZ-HHH9LE1H?H9H4HH9t|H4HHH HHHHHLHHHHDHHWHHHfHL4 HHL[LHDžtLLHEtAHLLIIILLLLAD 1HHHHt L#LHÃЃ HHfBoIHI9LE1H?H9H4HH9t(nHHHHHEHHHHHHHHHDžtIދAALˠމLHLMtLLHE1EAϋu6THHfB@HxΡLH`HHHH`Mht#HfA]E1fH|E1AE%A@f%nHF+AdH%(H;EDHĸ[A\A]A^A_]ËH<u HHtDTHu HtEtyH`<D EDD_E1E1tL1iE1@dHL MHE19H-E~EHxfAX tcfAEE1A@Hx E11HH- AEE1Hf.DUHAWAVSH(HIdH%(HEHtH@r,EELuLuEH}HHAfAD^Ex*Hu1tHu1ԜDu }xHtfADdH %(H;Mu H([A^A_] ffff.UHAWAVAUATSHxIdH%(HEMHfE1fHhDžAAHxHDžHHE1Dž1HE1L @LNDD HHc HDDH1HDžE1Dž1HxE1 H vHcHȉAb փ*HhHc H(HHBI 1HA փ*oHhHc H(HHBI .WH HcHȉAAAA1ۃE[ H HcHF2> H1DAA Hу7 H=HcHHhD DžHxu ЃgtOAȹDOсɀHщHcWMHHHORWHxDG4HDGHA HBHHHJyHxAZ HBHHHJNHA2 HOHQHWH HȺHHHLHD譙-HHHD@@DD H* HLM!ɀAy AAApDEb dAlu.HAI< ;@A A ؃ f0DHcH(HHGI؃ f0DHDHcH(HHORHcH(HHGI HA]1ڃ0ށҍHD'yfDž0AQfHAȉfx=u8u3ك@ HcP(HOHLc)HcH(wHHO@LHGHHHOLMLH߉؁ ʉEfD؄IDHEfHHHxFAʁڹOHHDHʅu*HHHt^A1HHDHHHH1IZ09GT0H΅WI9vH)HFDt t80uHHH0HHDEtAo@uHHHu'hHffDž SfDž-EHGHHHOf HfHHDžEHOHQHWH HH VHDхHtHf9t HuHH)HHDžMψƅHIfHULDžLMHH HDхH>1ɀ< tH9|HWfDž+Hx)H)p tuMː~FA@tIxt% LMnMLAtAAAuEA@t IxHM΅YL fIA@AMtIxtLLt AAuL LA8TuOA@t E1Ixt$?L裒LAADE˃q MHAǃuStM~NA@tIxt%0LM>MLAtAAAu EMEHDDrL VMHLÅ HFtH~t葑DȉMHcIAAA@Ht IxM΍ZIfIA@AtIxtLLt AAuP A8TBLA@t E1Ixt$?LLAADE˃nDM ADE1pȃtyDELxA݋tfff.~cA@tIxt/ LAL+IDpLfAAuVALDAAP(HOH@LD=HGHHHOHHt2HHHt)HHDžHHHF4u HIIA@tIxtYLM MLAŃDDDžAffffff.EDfAfL/ALDžALMA1H&(wwHHO@u(wxHOH@D%fHDžHGHHHOLcHGHHHOLwHOHAHGDcHOHAHGDN@HɃXwH 6L DHcHD$AA&AEt,At&(wHGNAdH%(H;EuDHx[A\A]A^A_]fy uHc AE1UHAVSIHt@Mt;AHL9A#sE1Et'LF-HAIAI1AWff.1HI 0AGAI HL9sI9HvL9sHAAADAItIP1H9s;ILqY@2HH9HIr""[A^]ffff. AHD DE1 AHD D f.UHAVSIHt@Mt;AHL9A#sE1Et'LF-HA,IAI1AWff.1HI 0AGAI HL9sI9HvL9sHAAADAItIP1H9s;ILqY@2HH9HIr}""[A^]ffff.E1UHSPHEH3SK LCLKC AA(H;u H5'3{ t!Hu/1H[]UHAWAVATSHH['L H3H{L{ t!Hɉu/H;ȉuH5'Lp&6LL3{H[tbHHHP8M$LL2A$xA;$|I$HI$A$xA$xbHtLHHP M|$HLL1A$A;$}*ID$@HI\$@A$A$[A\A^A_]H LL[A\A^A_]:5f.UHAWAVAUATSPIIA_(HҨ'L(A uXMgMMd$M(LL1AA;}yAAI I$M ]MLL0AA;}#IIMAALLLLLL84H[A\A]A^A_]UHAWAVSHIHdH%(HEHK A$H5'H4Ƌvdy,~1uq4H=&;7uHsH9q@uSL{8EEMt?A?HuHU誏t+}tEAGAGH{ G,Hs 1 yPAdH%(H;Eu1H[A^A_],AO$H'HȋHd~ u.P'u!G4H &;uH9w@@tD1A1Ɉ EHG8ff.UHAWAVAUATSH8HuL?E1MxH}Dg H&D0HC'HHEE1L'1DeDmAMff.MM<$E;t$El$$AI|$(H/&D90ML$8McA1ML'~q11ffffff.ILL9tFHq0^$N,(Iڋ[duD9v4uIYH9^@tffff.1@ƅHL9‰|D9|ffff.1ٚJM MEl$$I|$(M<$uJID$8xt?HMȋu H)HH'I۱fE;t$AH&D90AML$8McA1M~f11@IDL9tFHX0K$C,(I ˋIduD9s4uIIH9K@tffff.1ɅƉHL9‰|D9D|%f.M1覙Hߟ'IۋMԄu!MAH}H'IAH}AD$ EI\$8G$IÃxdt EGPEHSHu7 MEtHsH}LHMMDeAH}LmLHbbHsELMtMԃDmAMH'I DmЋMDmt"HMȋȉu(DH8[A\A]A^A_]fHwH G$H 'HH`@du0…utO,t1H- ffff.G$H V'HD@`@du0EutO,t1fDUHAWAVAUATSHHDEĉMUAIdH%(HEA^H'L(I~`HEMfI$HE]u3I`HEHMȺLoH}ILMuD}LuMLL)I1HAt HAHIAXD)AXLLz-1EtLuLMuID}:@1HLuLMuID}tW@0@ @1IMt1AAO?9AF(A;AAAHODȃEȉMI1ɃIvLL_EuRMtMMfMIhLH(AA;}rAAI`IM`WMtmI^MHLq(AXA;\}4II$MAXAXLLHLHL+EtWIF~ǀe%I~~%LJH5'Hp+Ha`EdH %(H;M&HH[A\A]A^A_]E9AF(AAID$ML$8EAD$ H[ &AD$INAD$1AAD$$HIL$(uAD$$I|$I^ IF H@I^ IF ID$0H@(IcAMdHz$u3IMF8MIvIN0LguLMLtEpAyu,E1HU tIuDEEDHugMĄHHGHHHyH8EOE1ɃIvLL\IvI~ ?MĄt7HID$HtJI $LaL oHHHHt7HOH99HHI$Ht5IL$L!7HI$!HGH8Hx@AA ID$L L`@AA1 ff.tHHFHt-HHpH7GHGHHtHFH0HwGHHFH7HwGtHHFHt-HHpH7GHGHHtHFH0HwGHHFH7HwGHHw0HW8HG @,1@UHAWAVSHdH%(HELwH_ EC$H З'H@`s,~qL}߅t:f.1HLLtK}u>{,=fffff.1HLLPtC,ȉC,}uC,dH%(H;Eu 1H[A^A_]@UHAWAVATSHIHdH%(HEEC$H5'HƋ@`S,~rDLeׅt6fDHLLDtK}u>{,=ffff.HLLDtC,ȉC,}uC,dH%(H;Eu H[A\A^A_]offffff.UHAWAVSHdH%(HELwH_ s,EC$H 'H@`s,~nL}߅t71HLLtK}u>{,=fffff.1HLLtC,ȉC,}uC,dH%(H;Eu 1H[A^A_]HG )p,1fDHHHy 0tOHqHfffff.UHAWAVAUATSHIHC0~ C0HUH-'L(ILHuw!IE1HAt HAIIA8D)A8LHu$Eu .HtWH@IǸMtEH&C4H}ЋC8H{@L{HC0CPI_C(HpLۊ1H[A\A]A^A_]f.UHAWAVAUATSHHdH%(HEHC HH0A jHH H5G&;THx@H;{FE1ɉH08H З'L!LxHHpLZHsH{ MteH{M$H}LA$8A;$<}'I$IM$A$8A$8L?H}Ls#HC @0@4@8W@@L{H[ EC$H 'Hx`C,Let*1HLLt=}u0{,/1HLL~tC,ȉC,}uC,dH%(H;EuDH[A\A]A^A_]ifG0G4G8WG@HUHAWAVAUATSHHMHuȋO Hj&EH'HuL'ML'E1MH}YHEMHUTL}AD$$AAAAI|$(M<$H%DAt$A9uMT$8McJ1M11$IT$0H}yxMdIDL9tVMH@0Dx$P,$H 'J[duD9@4u IZH9X@tf1ȅMfffff.HL9Ή|D9|ffff.1iEtEtEA;D$u H}LoyMMEE1XEffff.MEn$DAI~(M&EԨuKIF8xtAHMȋMԃuUH$HߋUfffff.AF$H:%DAvA9UMV8McJ1M~z11ILL9tVHI0Q$DY,E&H'HӋRduD9A4uIRH9Q@t$@1EEffffff.HL9Ή|D9}ff.U1ֈuZEtEtEA;Fu H}LwE1MIV0H}CwuEDL}MMEA;D$u)E|$ Mt$8H}G$H 'HxdtE1LvdDoPIVHu"tIvH}LHMv}MԀH}H]HLTQIvAHDcAEt H}wEԨt"HMȋȉuDHH[A\A]A^A_]EHEAfffff.SH%DD;NL^8McS1M~u1Ln'1fff.IDH9tFHH0Y$A,(I؋[duD9I4uI[H9Y@tffff.1Ʌх‰HL9׉|1D9[HU%G4G8Hw@fDf.Df.f.DU7]U7]UHAWAVAUATSHMMHIIdH%(HEfDžDc/Dž@/proLFHcIgfffffffLfHIHH?H<<)0HHH HHwHL)H|>HH?HHHN1fff.FFHHH9|fFs/mapH@11<LHcؿ"AE1HIIgLL(L MILH0fLM)M~:1ffffff.ALt HL9|LLLK44H0HL)<[IMO,7I9LsHL)L)HLLXJ3IDM9}*f.B<3 t9IM9|Offffff.HHI?fff.ILLL7fff.HIDH t tH11HH T HHHrH rHrHw H©HrHwHHffff.HgHHHHQD EtHT H:E1Lrffffff.HI t tH11 fffff.HH \2HIHHxH rHxHwHHxHw HHHHuf.ZHIƀ t tHs1HDHHZHI< wHsH8HHv*f.ZHIƀ t tH11ffff.HH \2HIHHCH rHCHwHéHCHw HHHHHH8ffffff.HI@2@ t@ tHb1I?? @A6HIHHXH rHH%wIrH9 H@t M H)1IMVIIA t tM1I?? A\>HIHHPH rHH%wIrIHuA^II€ t tMsHHH a1MI\>HHCMPH rHE1DH[A\A]A^A_]ffff.UHAWAVAUATSPMIIIH~H߉LLMMH[A\A]A^A_]j@f.UHAVSHLHW"HuL[A^]H UHAWAVAUATSH8IdH%(HEM4$M|$IG HEIG(HE1Lm1Lޅt.LvxCLLMU.ffff.HU'xLHUMUÃuI|$ t7HU1Lx ID$ HEHULMUI$I|$LW0dH %(H;MuH8[A\A]A^A_]UHAWAVATSHHIdH%(HEII{uD{u>HSPHHMLt#HEHL!IL!H HIIHH=H=c{YHHHDHHHHLH&H HIVHI9T@ Kr+HsPHHHLHH?r+HSXHHHLHH?HHI1HHHH IHHL!II!I MC<u*HCPH%H"HI!I MC<uHCXH1HI!I MdH%(H;Eu H[A\A^A_]bfUHAWAVSPIHIH11HHZǃHH Hx1H;vH11fD:H‰HH H@xHH1@@HDH?HGH 11ffff.LLzǃHH Hx1HucA?vu]H11ffff.:H‰HH H@x1:u'HH1@@HDH?HGH I6H[A^A_]ffff.UHAWAVAUATSH8MHIIHdH%(HEH{IILAHHCHE1L9y AE1Hq^L5JZE1E1 ffffff.LLMMMHF1 H Y4HHAH^MMMLL A? HLfA? HFDAHIL9 x AB? HHIqHl H6]Hc4HHHHIAHAJ?" HHHHHHHLH ELH fEHL ELHA? DALAJAA? AJD Ѓ?o HAJL)ɉD Ѓ?F H{AB?K HHAr? HHH:AB? HHAB? Az? LMMMLMMHHHMLMMMLAJ?? HHHHLHHiAJ?+ HHAA?DH!A%AJ?HHAA?D1HtHHHHHAAJ?HHAA?CDHH)HAJ?=HHAA?D1HtH1HHHAAJ?HHAA?D1HHHHAJ?aHAJ?@HAJ?EHHAA?DH A?AJ?HHAA?DHAAJ?HHLHAR?HHAA?EDHӤAAR?FHHAA?DHӬA@AR?HHAA?DHӼAAJ?HHAA?yDH1AAA?TDHHHIHI|AJ?>HHAA?D1H9@[AJ?HHAA?D1H9@AJ?HHAA?kD1H9@AJ?iHHAA?$D1H9@AJ?"HHAA?D1H9@BAJ?HHAA?D1H9@HA1HH%IHEHDHHH!HHHAHaHHAH@LAADȃAtEȸEAAAHNPIKcLDIHDIHDIHLIH IH@uLtAH7T@HOHHcHDHE1HTLE11DHIDÃHI HExoE11DHIDÃHI HExHHA@AIDH?IGI #DHDHLHILMMM1Iw HNB4HHLIمAHSMMMLA?HL=E11HIǃHI Hx_E11HIǃHI HxHH@IDH?IGI !f1HQI<@EIc LHN1 HM HHH%AʸA?wDHHH1dH %(H;MuAH8[A\A]A^A_]ø1Iw H EMB HH |f.fUHAWAVAUATSHHhDUdH%(HEH:W)E)E)E)pHED7H_I9H]tBEIL2HcWHAHHH}EtA1EtMH_ LwIH]L2HW HH}1EtHH9s HhIH)EIEHXDdEHEH{H9H}t$DCHH]AɸA9H/AHHC HSHHEH{ HH]H9HxD HCHEAD<r EEDCHSHUEtZDEȊCHSHUtJEɊCHSHUt8EʊCHH]uEHf.:HRHUuE111f.HHUǃHH HxH]E11f.HHWHU؃HI HxHHE1@IDH?IGI AL]uGHH}HE(11HHUǃHH HxH]HE1Azu EAf?HH}xL%zOIBD=ȉɀIcLHEHHEMaffff.HEHHEHEH$HhHULXLM/LyHEHHEMII_tE~]HEHpL}L<$HULMHhLXML<L<$HULMHhMHEI$HEID$HEID$1Et-HE11DHHE׃HH HxHML$ML<$HUHhLM 1dHHID$0H=(;HIL$8Ht]EtHU2furfuHHUHD]H]LuHEHA@(p(M(U(]Y0Q I1dH %(H;MuHĈ[A\A]A^A_]H.f.@f.DUHAVSIIfIFPDH{H[0HtH{ HtлIdžfAFD[A^]f1f.H(IAAHA IB Q(AR0Bs HLu4HA8IBIBA@IB(AB4EtIJ8IB81ÐLA APLG(LO0HHoxLgHLoPLwXL`HwpHHHHHQHHhff.fUHSPHC% @fCC$? C1H[]UHAWAVAUATSHMAHAdH%(HEE1H۸EDmHEHwHcLH}远HtNHp1HDuczA@t\DADNMtFAzu=E'Az2IcH H1HEA̅DIDMtAdH%(H;EuDH[A\A]A^A_]T@1;CHH׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ/Ep _O 9"xcI~ѡ @bDa 2ӳ%AH2gH 8ޕw.IijՓԼ.GaJ:JpYKZ<4B GuRW̺H2F49/jHFh<ٟ2C|.YKuIU"ӻJA!&?ߺ E|wb ~ >sCש_DIoFv9؈Q1 MO8(Q/NErSOFTWARE\Policies\Microsoft\Windows\Windows Error Reporting\DebugApplicationsSOFTWARE\Microsoft\Windows\Windows Error Reporting\DebugApplicationsSOFTWARE\Microsoft\Windows NT\CurrentVersion\AeDebugDebuggerAutoSOFTWARE\Microsoft\Windows NT\CurrentVersion\AeDebug\AutoExclusionList @Hb%08x;%08x;%plibcoreclr.so/libmscordbi.soP9Exception16PAL_SEHExceptionCoreCLRCreateCordbObject/libmscordbi.soEX_CATCH line %d 29NativeExceptionHolderCatchAll25NativeExceptionHolderBase׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a @bDa 2ӳ%AH2gH 8ޕw.IijՓԼ.GaJ:JpYKZ<4B GuRW̺H2F49/jHFh<ٟ2C|.YKuIU"ӻJA!&?ߺ E|wb ~ >sCש_DIoFv9؈Q1 MO8(Q/NE-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ16CLRDebuggingImpl(I6F l/NEOpenVirtualProcessImpl2LoadLibraryWOpenVirtualProcessImplOpenVirtualProcess2%slibmscordaccore.soFZ<4B GuR13ICLRDebugging8IUnknownq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAlt| ׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ11HRException9Exception14HRMsgException20OutOfMemoryException12SEHException19DelegatingExceptionS_OKS_FALSEE_UNEXPECTEDE_NOTIMPLE_OUTOFMEMORYE_INVALIDARGE_NOINTERFACEE_POINTERE_HANDLEE_ABORTE_FAILE_ACCESSDENIEDException code 0x%.8xUnknown exceptionThrowHR: HR = %x EX_THROW Type = 0x%x HR = 0x%x, line %d Out Of MemoryP11HRExceptionP14HRMsgException (0x%.8X (%S)q ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNA$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ%RP{ePPxnn &a&&&'&&a&(k((((((k(*!******!*,,0,0,R,0,0,,........ 2111*111*1S8!8@8@8B8@8@8!8:09p9p99p9p99;:;;;;;:<<<<<<<<>=>> >>>=׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNA׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤP20OutOfMemoryException******* DllMain THREAD_DETACH called Thread dying ******* ׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ\/q ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ19UtilExecutionEngine16IExecutionEngine16IEEMemoryManager׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤmscorrc.debug.dllmscorrc.dll\mscorrc.debugmscorrc׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ.q ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNA?\\\\\\\\RpP~&&&&&&&&&&&&&Z&)&&)i&Z)))))))))))))))))))))))))))))))))))׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ3dLdJkΣHF+NER8M{4ƻ4`0w= OC&8I_I6/Ep _O 9"xcI~ѡד 4` $\ $4`u&LNw ܼEJ B܅D=ӟNܛK"Wt BBDю2gJbկ` t!B@!NFv1.0.3705v1.x86retailCOMPLUSv1.x86retailCOMPLUSDllGetClassObjectClrVirtualAllocWithinRange request #%u for %08x bytes in [ %p .. %p ], query count was %u - returned %s: %p successAdditional reason: Address space exhausted. Additional reason: VirtualQuery operation failed. GetNumaHighestNodeNumberGetNumaProcessorNodeExVirtualAllocExNumaGetLogicalProcessorInformationExSetThreadGroupAffinityGetThreadGroupAffinityGetCurrentProcessorNumberExLOCALAPPDATA׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤAddRejitNopsADULazyMemoryReleaseADURetryCountFinalizeOnShutdownARMEnabledJitPitchEnabledJitPitchMemThresholdJitPitchMethodSizeThresholdJitPitchTimeIntervalJitPitchPrintStatJitPitchMinValJitPitchMaxValdesignerNamespaceResolutionBreakOnBadExitBreakOnEELoadBreakOnFinalizeTimeOutBreakOnNGenRegistryAccessCountBreakOnRetailAssertBreakOnSOEnableDiagnosticsDbgDACSkipVerifyDllsDbgDisableDynamicSymsCompatDbgEnableMixedModeDebuggingInternalOnlyDbgNoForceContinueDbgPackShimPathDbgRedirectDbgRedirectApplicationDbgRedirectAttachCmdDbgRedirectCommonCmdDbgRedirectCreateCmdDbgTransportProxyAddressDbgWFDETimeoutUNSUPPORTED_DbgDontResumeThreadsOnUnhandledExceptionDbgSkipStackCheckMiniMdBufferCapacitydisableStackOverflowProbinglegacyCorruptedStateExceptionsPolicyFailFastOnCorruptedStateExceptionGCBreakOnOOMgcConcurrentgcConservativegcServergcForceCompactGCgen0sizeGCStressMixGCStressStepGCStressMaxFGCsPerBGCStatsUpdatePeriodSuspendTimeLogGCMixLogGCLatencyLevelGCConfigLogEnabledGCLogEnabledGCLogFileGCConfigLogFileGCLogFileSizeGCCompactRatioGCPollTypeGCRetainVMGCSegmentSizeGCLOHCompactgcAllowVeryLargeObjectsGCStressGCStressStartGCStressStartAtJitgcTrimCommitOnLowMemoryBGCSpinCountBGCSpinHeapVerifySetupGcCoverageGCNumaAwareGCCpuGroupGCHeapCountGCNoAffinitizeGCNameConvertIbcDataDisableHotColdDisableIBCUseIBCFileJitAlignLoopsJitEnableNoWayAssertJitFramedJITMinOptsAltJitNameAltJitAltJitExcludeAssembliesAltJitNgenJitOptimizeTypeJitPrintInlinedMethodsJitTelemetryJitTimeLogFileJitTimeLogCsvJitFuncInfoLogFileJitLockWriteTailCallOptTailCallLoopOptNetFx40_PInvokeStackResilienceAltJitAssertOnNYIJitRegisterFPJitELTHookEnabledJitMemStatsJitVNMapSelBudgetFeatureSIMDSIMD16ByteOnlyEnableAVXMultiCoreJitProfileMultiCoreJitProfileWriteDelayInterpreterFallbackForceLogLoaderOptimizationCoreClrBinderLogDisableIJWVersionCheckEnableFastBindClosureDisableFXClosureWalkCodeHeapReserveForJumpStubsNGenReserveForJumpStubsBreakOnOutOfMemoryWithinRangeLogEnableLogFacilityLogFacility2logFatalErrorLogLevelLogPathLogToConsoleAssertOnBadImageFormatMD_DeltaCheckMD_ForceNoColDesSharingMD_PreserveDebuggerMetadataMemorySpinInitialDurationSpinBackoffFactorSpinLimitProcCapSpinLimitProcFactorSpinLimitConstantSpinRetryCountMonitor_SpinCountNGen_JitNameNGenFramedHardPrejitEnabledEnableHardbindingNGenEnableCreatePdbNGenSimulateDiskFullPartialNGenNgenAllowMscorlibSoftbindperformanceScenarioCOR_ENABLE_PROFILINGCOR_PROFILERCOR_PROFILER_PATHCOR_PROFILER_PATH_32COR_PROFILER_PATH_64CORECLR_ENABLE_PROFILINGCORECLR_PROFILERCORECLR_PROFILER_PATHCORECLR_PROFILER_PATH_32CORECLR_PROFILER_PATH_64ProfAPI_ProfilerCompatibilitySettingAttachThreadAlwaysOnMsBetweenAttachCheckProfAPIMaxWaitForTriggerMsProfAPI_DetachMinSleepMsProfAPI_DetachMaxSleepMsProfAPI_AttachProfilerMinTimeoutInMsETWEnabledETW_ObjectAllocationEventsPerTypePerSecProfAPI_ValidateNGENInstrumentationPerfMapEnabledPerfMapIgnoreSignalStartupDelayMSForceEncStressThreadCountINTERNAL_ThreadSuspendInjectionThread_DeadThreadCountThresholdForGCTriggerThread_DeadThreadGCTriggerPeriodMillisecondsThreadPool_ForceMinWorkerThreadsThreadPool_ForceMaxWorkerThreadsThreadPool_DisableStarvationDetectionThreadPool_DebugBreakOnWorkerStarvationThreadPool_EnableWorkerTrackingThreadPool_UnfairSemaphoreSpinLimitThread_UseAllCpuGroupsHillClimbing_DisableHillClimbing_WavePeriodHillClimbing_TargetSignalToNoiseRatioHillClimbing_ErrorSmoothingFactorHillClimbing_WaveMagnitudeMultiplierHillClimbing_MaxWaveMagnitudeHillClimbing_WaveHistorySizeHillClimbing_BiasHillClimbing_MaxChangePerSecondHillClimbing_MaxChangePerSampleHillClimbing_MaxSampleErrorPercentHillClimbing_SampleIntervalLowHillClimbing_SampleIntervalHighHillClimbing_GainExponentEXPERIMENTAL_TieredCompilationTieredCompilation_Tier1CallCountThresholdTieredCompilation_Tier1CallCountingDelayMsTieredCompilation_Test_CallCountingTieredCompilation_Test_OptimizeTier0VirtualCallStubLoggingDisableWatsonForManagedExceptionsZapBBInstrZapBBInstrDirZapDisableZapRequireZapRequireExcludeListZapRequireListZapSetReadyToRunReadyToRunExcludeListReadyToRunLogFileEnableEventLogEventSourceFilterEventNameFilterPreferComInsteadOfManagedRemotinglegacyComHierarchyVisibilitylegacyComVTableLayoutnewComVTableLayoutPInvokeInlineInteropValidatePinnedObjectsInteropLogArgumentsLogCCWRefCountChangeEnableRCWCleanupOnSTAShutdownLocalWinMDPathAllowDComReflectionEnableEventPipeEventPipeOutputFileEventPipeConfigEventPipeRundownDisableConfigCacheDisableStackwalkCacheDoubleArrayToLargeObjectHeapIgnoreDllMainReturnlegacyNullReferenceExceptionPolicylegacyUnhandledExceptionPolicyNativeImageRequireNO_SO_NOT_MAINLINENoGuiOnAssertNoProcedureSplittingNotifyBadAppCfgPrepopulate1RestrictedGCStressExeRSStressLogShimDatabaseVersionSleepOnExitSuccessExitSymbolReadingPolicyTestDataConsistencyThreadGuardPagesTimelineTotalStressLogSizeTURNOFFDEBUGINFOUseMethodDataCacheUseParentMethodDataVerifyAllOnLoad!׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ 77770000׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ%.*gUUQQQiQQQQ OO5OOOOOOOOOOOOOOOOOOOOOOOOOOO;OOOOOOJOOOOOOAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA/AAAAAAAAAAAAAAAAAAAA/AAA#################2&x&x&R&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&K&x&x&x&%x&x&x&x&x&x&x&x&x&x&%&&%&%&&&&&&&&&&&6&&&&&%&&&&&&&&&&&%%%%&%&&&&&%&&&6&&%&&%{''''''''''''''''') * *) * * * * * * * * * * * * * * * * * * * * * * * * * * *) * * *) * * ** * * * * * *))^*)^*)^*^*^*^*^*^*^*^*^*^*^*)^*^*^*^*u)^*^*^*^*^*^*^*^*^*^*)u))))^*u)^*^*^*^**u)^*^*^*)^*u)^*^*u)Z)(c)((null)(null)00000000 PAL_OUTPUTDEBUGSTRINGProcess is terminating due to StackOverflowException. Process is terminating due to StackOverflowException. p""*"""2"":""BJ""R""Z""""""""b""j"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""&͈&͈ ͈Ԉ͈ۈ!ۈԈߌ>Չ>߉/>>ˉ%bbpbbb[bb~bbMibbbbTbbbbbbbbbbwbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbvvvvvvovvvva}vvvvhvvvvvvvʅvvvʅvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv=*888?888F88M*88T[88b*88i88818*888p8w88~8888888888888888888888888888888888888888888888888888888888888888888888888888888881!Z@ȘϘ֘ݘ_Z_")0Z7>EZLZSZLLL4LLL?@AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz[\]^_`aAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ{|}~ H            !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^__``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~          PPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^__``aabccddeeffgghhiijkkllmmnnooppqqrrsstuuvwwxxyyzz{{||}}~~          !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOQQRRSSTTUUVVWWXXYYZZ[[\\^^__``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVYaabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3!@A K` jq^   4< X  b f  p  +        *<  Y f  p  .      ,< \ f  p  !     0> ` f   0      1>  ` f  9?@OP Z  4 @(q#            !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^__``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~            !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEHHIIJJKKLLMMPPQQRRSSTTUUVVWWYY[[]]__``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}  0 ( 00 j 0p z   $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$0H000000A0S000Y0011Nw~>P G|H !!""##$$%%&&''(())**++,,--..//00112233445566778899::;AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[f pq,2 27InsufficientBufferException17ArgumentException24DecoderFallbackException24EncoderFallbackException26DecoderReplacementFallback26EncoderReplacementFallback15DecoderFallback15EncoderFallback32DecoderReplacementFallbackBuffer21DecoderFallbackBuffer32EncoderReplacementFallbackBuffer21EncoderFallbackBuffer27ArgumentOutOfRangeException21ArgumentNullException24EncoderExceptionFallback30EncoderExceptionFallbackBufferUnable to translate Unicode character to UTF-824DecoderExceptionFallback30DecoderExceptionFallbackBuffer/dev/zero>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>EDEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEOGOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO@ ?/proc/self/statm/proc/self/mountinfo - - %s %*s %s,%*s %*s %*s %s %s /proc/self/cgroup%*[^:]:%[^:]:%smemorycpu/memory.limit_in_bytes/memory.usage_in_bytes/cpu.cfs_quota_us/cpu.cfs_period_usNULLPAL_DBG_CHANNELSPAL_API_TRACINGatPAL_DISABLE_ASSERTSPAL_API_LEVELSallstderrstdoutCan't open %s for writing : debug messages will go to stderr. Check your PAL_API_TRACING variable! ERROR : pthread_key_create() failed error:%d (%s) ERROR : fclose() failed errno:%d (%s) ERROR : pthread_key_delete() returned %d! (%s) {%p-%p} %-5s [%-7s] at %s.%d: ERROR : buffer overflow in DBG_printf_gcc%s%sERROR : fflush() failed errno:%d (%s) ERROR: errno changed by DBG_printf_gcc ERROR : buffer overflow in DBG_printf_c99ERROR: DBG_printf_c99 changed the errno. ERROR : pthread_setspecific() failed error:%d (%s) ENTRYTRACEWARNERRORASSERTEXITPALLOADERSHMEMPROCESSTHREADEXCEPTCRTUNICODEARCHSYNCFILEVIRTUALSOCKETDEBUGLOCALEMISCMUTEXCRITSECPOLLCRYPTSHFOLDERSXS%s=%sError %u/dev/urandomN7CorUnix14CPalObjectBaseEN7CorUnix10IPalObjectEN7CorUnix15CSimpleDataLockEN7CorUnix9IDataLockEN7CorUnix26CSharedMemoryObjectManagerEN7CorUnix17IPalObjectManagerEN7CorUnix23CSimpleSharedMemoryLockE(21SharedMemoryException/tmp/.coreclr.XXXXXXGlobal\Local\sessionglobal/tmp/.dotnet/shm/tmp/.dotnet%ud21NamedMutexProcessData27SharedMemoryProcessDataBase<<;== N7CorUnix26CPalSynchronizationManagerEN7CorUnix26CThreadSynchronizationInfoEN7CorUnix26IPalSynchronizationManagerEN7CorUnix22CThreadInfoInitializerEhhhh.|I||N|||||?!!!!!!!!!)1!!!9!!!!!!!!!!!!!!!!uuuuuuuuu}uuuuuuu8uuuuumuuuuuuu8ѸŸ̸clix/proc/%d/maps%p-%p %*[-rwxsp] %p %x:%x %d %s COMPlus_DbgEnableMiniDumpcreatedump%dCOMPlus_DbgMiniDumpName--nameCOMPlus_DbgMiniDumpType--normal--withheap--triage4--fullCOMPlus_CreateDumpDiagnostics--diagFATAL ERROR: Failed to lock the flushProcessWriteBuffersMutex lockFATAL ERROR: Failed to change helper page protection to read / writeFATAL ERROR: Failed to change helper page protection to no accessFATAL ERROR: Failed to unlock the flushProcessWriteBuffersMutex locklibcoreclr.so/clrst%08x%016llx/clrco%08x%016llx/proc/%d/stat%*c %*d %*d %*d %*d %*d %*u %*lu %*lu %*lu %*lu %*lu %*lu %*ld %*ld %*ld %*ld %*ld %*ld %llu clr-debug-pipe-%d-%llu-%sPATH"AN7CorUnix10CPalThreadEN7CorUnix14CThreadSEHInfoEN7CorUnix14CThreadApcInfoEN7CorUnix14CThreadCRTInfoE*N7CorUnix21CThreadSuspensionInfoEN7CorUnix14CThreadTLSInfoE8>>U^>>>>gpytt+;K[k{d*8D%/J d & l N  B R A i s  |  .eh_frameELF.gnu_debuglink/usr/lib/debug/.debug//+1+/++/+/+/+/+/+/+/+/+/+/+/+2+/+/+/+/+/+/+/+/+/+/+/+/+/+/+/+8+The operation completed successfully. Incorrect function. The system cannot find the file specified. The system cannot find the path specified. The system cannot open the file. Access is denied. The handle is invalid. Not enough storage is available to process this command. The environment is incorrect. An attempt was made to load a program with an incorrect format. The access code is invalid. The data is invalid. Not enough storage is available to complete this operation. The system cannot find the drive specified. There are no more files. The media is write protected. The device is not ready. The device does not recognize the command. The program issued a command but the command length is incorrect. The system cannot write to the specified device. The system cannot read from the specified device. A device attached to the system is not functioning. The process cannot access the file because it is being used by another process. The process cannot access the file because another process has locked a portion of the file. Too many files opened for sharing. Reached the end of the file. The disk is full. The request is not supported. A duplicate name exists on the network. The network path was not found. The specified network resource or device is no longer available. The network name cannot be found. The file exists. The directory or file cannot be created. The parameter is incorrect. A write fault occurred on the network. The disk is in use or locked by another process. The pipe has been ended. The system cannot open the device or file specified. The file name is too long. There is not enough space on the disk. This function is not supported on this system. The semaphore timeout period has expired. The data area passed to a system call is too small. The filename, directory name, or volume label syntax is incorrect. The specified module or one of its dependencies could not be found. The specified procedure could not be found. There are no child processes to wait for. An attempt was made to move the file pointer before the beginning of the file. The file pointer cannot be set on the specified device or file. The directory is not empty. The recipient process has refused the signal. The segment is already unlocked. The specified path is invalid. The requested resource is in use. The operating system cannot run %1. Cannot create a file when that file already exists. Cannot run %1 in Win32 mode. %1 is not a valid Win32 application. The system could not find the environment option that was entered. The filename or extension is too long. All pipe instances are busy. The pipe is being closed More data is available. No more data is available. The directory name is invalid. Attempt to release mutex not owned by caller. Only part of a ReadProcessMemory or WriteProcessMemory request was completed. Attempt to access invalid address. Arithmetic result exceeded 32 bits. The I/O operation has been aborted because of either a thread exit or an application request. Overlapped I/O event is not in a signaled state. Overlapped I/O operation is in progress. Invalid access to memory location. Recursion too deep; the stack overflowed. Invalid flags. The volume does not contain a recognized file system. Please make sure that all required file system drivers are loaded and that the volume is not corrupted. The volume for a file has been externally altered so that the opened file is no longer valid. The process terminated unexpectedly. No mapping for the Unicode character exists in the target multi-byte code page. A dynamic link library (DLL) initialization routine failed. The request could not be performed because of an I/O device error. While accessing the hard disk, a disk operation failed even after retries. A potential deadlock condition has been detected. An attempt was made to create more links on a file than the file system supports. One of the library files needed to run this application is damaged. One of the library files needed to run this application cannot be found. Element not found. The operation was canceled by the user. The operation being requested was not performed because the user has not been authenticated. An internal error occurred. The file or directory is corrupted and unreadable. The disk structure is corrupted and unreadable. Logon Failure: The target account name is incorrect. Insufficient system resources exist to complete the requested service. The paging file is too small for this operation to complete. This operation returned because the timeout period expired. The event log file is corrupted. The event log file is full. Data of this type is not supported. The version option is invalid. The specified image file did not contain a resource section. The specified resource language ID cannot be found in the image file. A required tag is not present. N7CorUnix19CSharedMemoryObjectEN7CorUnix27CSharedMemoryWaitableObjectEE                             M  u                          }       g     w/////EGxxxxxG;xxSxGxxxx8b00011D1q119%4919199999999999c4999959499999919444111949999 =4499r49)5994.2777777777777777777777777777777777777 <77777777777 <7777 <77777 <77777 <77 <.;;1;;;;;;;1;1;;2EEE50P 8PX700WP `h````ppxxxx(null)(null)J<< =8=C=p==9L=CE@C=C=CCCCCCCCCCC@CCCCUAC@CCCCCC>C`@(@>>>C(@CCCCL@ACC@CACCPA).Warning: Method has multiple semantics.Error: Method has invalid semantic association (token=0x%08x).Error: Method has semantic association (token=0x%08x) that does not exist.Error: MethodImpl overrides non-virtual method (token=0x%08x).Warning: [CLS] Global item (field,method).Error: Method has multiple semantic flags set for association (token=0x%08x).Error: Method has no semantic flags set for association (token=0x%08x).Warning: [CLS] Field in Interface.Warning: Unrecognized Hash Algorithm ID (0x%08x).Error: Unrecognized Processor ID (0x%08x) in Assembly.Warning: Unrecognized Processor ID (0x%08x) in AssemblyRef (token=0x%08x).Error: Constant parent token (0x%08x) is out of range.Error: Invalid Assembly flags (0x%04x).Warning: TypeDef (token=0x%08x) has same name as TypeRef.Error: InterfaceImpl has invalid implementing type (0x%08x).Error: InterfaceImpl has invalid implemented type (0x%08x).Error: TypeDef has security information but is not marked HasSecurity.Error: TypeDef is marked HasSecurity but has no security information.Error: Type constructor must have no arguments.Error: ExportedType has invalid Implementation (token=0x%08x).Error: MethodImpl has body from another TypeDef (token=0x%08x).Error: Type constructor has invalid calling convention.Error: MethodImpl has invalid Type token=0x%08x.Error: MethodImpl declared in Interface (token=0x%08x).Error: MethodImpl has invalid MethodDeclaration token=0x%08x.Error: MethodImpl has invalid MethodBody token=0x%08x.Error: MethodImpl has a duplicate (rid=0x%08x).Error: Field has invalid parent (token=0x%08x).Warning: Parameter out of sequence (parameter: %d; seq.num: %d).Error: Parameter has sequence number exceeding number of arguments (parameter: %d; seq.num: %d; num.args: %d).Error: Parameter #%d is marked HasFieldMarshal but has no marshaling information.Error: Parameter #%d has marshaling information but is not marked HasFieldMarshal.Error: Parameter #%d is marked HasDefault but has no const value.Error: Parameter #%d has const value but is not marked HasDefault.Error: Property has invalid scope (token=0x%08x).Error: Property has no name.Error: Property has no signature.Error: Property has a duplicate (token=0x%08x).Error: Property has invalid calling convention (0x%x).Error: Property is marked HasDefault but has no const value.Error: Property has const value but is not marked HasDefault.Error: Property has related method with invalid semantics (method: 0x%08x; semantics: 0x%08x).Error: Property has related method with invalid token (0x%08x).Error: Property has related method belonging to another type (method: 0x%08x; type: 0x%08x).Error: Constant of type (0x%02x) must have null value.Error: Constant of type (0x%02x) must have non-null value.Error: Event has invalid scope (token=0x%08x).Error: Event has no name.Error: Event has a duplicate (token=0x%08x).Error: Event has invalid EventType (token=0x%08x).Error: Event's EventType (token=0x%08x) is not a class (flags=0x%08x).Error: Event has related method with invalid semantics (method: 0x%08x; semantics: 0x%08x).Error: Event has related method with invalid token (0x%08x).Error: Event has related method belonging to another type (method: 0x%08x; type: 0x%08x).Error: Event has no AddOn related method.Error: Event has no RemoveOn related method.Error: ExportedType has same namespace and name as TypeDef, token 0x%08x.Error: ManifestResource refers to non-PE file but offset is not 0.Error: Decl.Security is assigned to invalid item (token=0x%08x).Error: Decl.Security has invalid action flag (0x%08x).Error: Decl.Security has no associated permission BLOB.Error: ManifestResource has invalid Implementation (token=0x%08x).Warning: [CLS] MemberRef has VARARG calling convention.Error: Constructor, initializer must return void.Error: Event's Fire method (0x%08x) must return void.Warning: Invalid locale string.Error: Constant has parent of invalid type (token=0x%08x).Error: ELEMENT_TYPE_SENTINEL is only allowed in MemberRef signatures.Error: Signature containing ELEMENT_TYPE_SENTINEL must be VARARG.Error: Multiple ELEMENT_TYPE_SENTINEL in signature.Error: Trailing ELEMENT_TYPE_SENTINEL in signature.Error: Signature is missing argument # %d.Error: Field of ByRef type.Error: Synchronized method in ValueType (token=0x%08x).Error: Full name length exceeds maximum allowed (length: %d; max: %d).Error: Duplicate Assembly Processor record (0x%08x).Error: Duplicate Assembly OS record (0x%08X).Error: ManifestResource has invalid flags (0x%08x).Warning: ExportedType has no TypeDefId.Error: File has invalid flags (0x%08x).Error: File has no hash BLOB.Error: Module has no name.Error: Module name is fully-qualified.Error: TypeDef marked as RTSpecialName but not SpecialName.Error: TypeDef extends an Interface (token=0x%08x).Error: Type/instance constructor marked PInvokeImpl.Error: System.Enum is not marked Class.Error: System.Enum must extend System.ValueType.Error: MethodImpl's Decl (token=0x%08x) and Body (token=0x%08x) method signatures do not match.Error: Enum has method(s).Error: Enum implements interface(s).Error: Enum has properties.Error: Enum has one or more events.Error: TypeDef has invalid Method List (> Nmethods+1).Error: TypeDef has invalid Field List (> Nfields+1).Error: Constant has illegal type (0x%02x).Error: Enum has no instance field.Error: Enum has multiple instance fields.Error: Cannot increase the maximum nesting level in Edit-and-Continue.Error: Module must be loaded in Edit-and-Continue mode.Variable type cannot be changed.Cannot get the local signature for the method.Field cannot be added to a value or layout type.Field properties cannot be changed.Edit-and-Continue impossible: Zap file was created without Edit-and-Continue flag set.Internal data structures missing method information.JIT unable to update internal structures.Internal type data structures are missing.Not allowed to change interface inheritance.Function 0x%08x had not yet been compiled.The ID 0x%08x had not yet been fully loaded or defined.The Module containing function ID 0x%08x is not configured for updateable methods.Method ID 0x%08x could not be updated.Profiling error: the method has no associated IL.Profiling error: the thread is unmanaged and has never run managed code before.Profiling error: this function may only be called during profiler initialization.Profiling error: in-process debugging must be enabled during profiler initialization.Profiling error: cannot get a JIT map because the profiler did not enable JIT map tracking.Profiling error: BeginInprocDebugging cannot be called more than once.Profiling error: in-process debugging not allowed during this profiler callback.Profiling error: the requested information is not yet available.Assembly '%1' security permission grant set is incompatible between appdomains.Unverifiable assembly '%1' failed policy check.Assembly '%1' already loaded without additional security evidence.StrongName APIs not supported on system.StrongName APIs could not locate a matching CSP.Policy exception occurred while processing '%1'.Failed to grant required minimum permissions to '%1'.Failed to grant permission to execute '%1'.Strong name validation failed for assembly '%1'.Assembly '%1' is missing the required strong name.Strong name key container not found.The public key for assembly '%1' was invalid.The allocated signature slot for assembly '%1' does not correspond to the generated signature size.Key pair does not match public key from assembly '%1'.Invalid custom attribute.The permission associated with this attribute is missing a required constructor.Unable to create an instance of the permission for this attribute.SecurityAction type invalid on assembly.SecurityAction type invalid on types and methods.Security custom attribute attached to invalid parent.Serialized security custom attribute is truncated or incorrectly formed.Serialized security custom attribute has unrecognized version.Security custom attribute has invalid SecurityAction.Security custom attributes cannot be referenced from defining assembly.Invalid SecurityAction for non-Code Access Security permission.Failed to load assembly '%s'.Failed to load assembly '%s' - %s.Failed to load type '%s'.Failed to load type '%s' - %s.Security custom attribute cannot be abstract.Security custom attributes do not support array or Type fields and properties.Unsupported enumeration base type.Failed to locate field '%s'.Failed to locate property '%s'.Unexpected exception processing attribute - '%s'.Unexpected exception processing attribute - HRESULT 0x%08X.IsolatedStorage operation failed.Unable to open the store.Unable to create store file mapping.Unable to map the store file.Unable to determine store file size.Unable to create mutex.Unable to lock the store.File Write failed.Cannot set file pointer.Unable to create the store directory.Store must be open for this operation.Store file is corrupt.Store version is not supported.Store file is not mapped.Block size is too small.Allocation size is too large.Allowed quota is fully used.Row not found.Unable to deprecate old store.Unable to determine the caller.Path length is too long.Machine Store is not supported.The DACL for the machine store is incorrect or could not be created.An internal error happened in the Common Language Runtime's Execution Engine.A security violation has occurred.An error relating to remoting occurred during the load of file or assembly '%1'.An error relating to serialization occurred during the load of file or assembly '%1'.Error: Missing method '%2' from class '%1'.Unable to load file '%1'.Method's type signature is not PInvoke compatible.Exception from HRESULT: Invalid PInvoke or UnmanagedFunctionPointer metadata format.Unable to load DLL '%1' or one of its dependencies: %2Unable to find an entry point named '%2' in DLL '%1'.Method's type signature is not Interop compatible.Synchronized attribute cannot be used with this method type.Invalid PInvoke calling convention. Thiscall requires that the first parameter is present and can be enregistered.Main method not found for type '%1'.Main method for type '%1' has invalid signature.The method returned a COM Variant type that is not Interop compatible.The method returned a VT_RECORD Variant, which is not supported by Interop.Unexpected error occurred loading type '%1'.Multiple methods named Invoke.Method's type signature contains a type that cannot be automatically converted.Function pointer was not created by a Delegate.Not a PInvoke method.MSCOREE.DLL load error.Two different copies of MSCORWKS.DLL have been loaded. First copy: %s Second copy: %s This is typically caused by having a registered MSCOREE.DLL that is different from the one that is statically linked with the application.Custom marshalers can only be specified for classes.No exception available to rethrow.Specified OLE variant is invalid.The default domain cannot be unloaded.Exception from HRESULT: 0x%1. Failed to load '%2'.Signature for the entry point has too many arguments.Entry point not found in assembly '%1'.Specified entry point in assembly '%1' is not a legal method.Entry point must be static.Entry point must have a return type of void, integer, or unsigned integer.Invalid managed/unmanaged type combination (String fields must be paired with LPStr, LPWStr, LPTStr, or ByValTStr).Custom marshalers cannot be used on fields of structures.Fixed sized array fields inside structures must have the MarshalAs SizeConst field set to the size of the array.Fixed sized array fields cannot have a SizeConst of zero.Invalid managed/unmanaged type combination (Classes with layout fields must be paired with Struct or Interface).Invalid managed/unmanaged type combination (Array fields must be paired with ByValArray).Invalid managed/unmanaged type combination (Strings cannot be paired with LPTStr for parameters and return types of methods in interfaces exposed to COM).The type definition of this field has layout information but has an invalid managed/unmanaged type combination or is unmarshalable.Mismatch has occurred between the runtime type of the array and the sub type recorded in the metadata.SafeArray of rank %1 has been passed to a method expecting an array of rank %2.Invalid managed/unmanaged type combination.Invalid managed/unmanaged type combination (chars must be paired with I1, I2, U1, or U2).Invalid managed/unmanaged type combination (booleans must be paired with I1, U1, or Bool).Invalid managed/unmanaged type combination (Byte/SByte must be paired with I1 or U1).Invalid managed/unmanaged type combination (Int16/UInt16 must be paired with I2 or U2).Invalid managed/unmanaged type combination (Int32/UInt32 must be paired with I4 or U4).Invalid managed/unmanaged type combination (Int64/UInt64 must be paired with I8 or U8).Invalid managed/unmanaged type combination (Int/UInt must be paired with SysInt or SysUInt).Invalid managed/unmanaged type combination (Single must be paired with R4).Invalid managed/unmanaged type combination (Double must be paired with R8).Invalid managed/unmanaged type combination (pointers must not have a MarshalAs attribute set).The type definition of this type has no layout information.Invalid managed/unmanaged type combination (String parameters and return types must be paired with LPStr, LPWStr, or LPTStr).Invalid managed/unmanaged type combination (StringBuilders must be paired with LPStr, LPWStr, or LPTStr).Invalid managed/unmanaged type combination (Delegates must be paired with FunctionPtr or Interface).Invalid managed/unmanaged type combination (function pointers must be paired with FunctionPtr).Invalid managed/unmanaged type combination (Interfaces must be paired with Interface).Invalid managed/unmanaged type combination (this type must be paired with LPStruct or Interface).Invalid managed/unmanaged type combination (this value type must be paired with Struct).Invalid managed/unmanaged type combination (the Object class must be paired with Interface, IUnknown, IDispatch, AsAny, or Struct).Invalid managed/unmanaged type combination (the Object class must be paired with Interface, IUnknown, IDispatch, or Struct).Invalid managed/unmanaged type combination (Decimal parameters and return types must be paired with Struct, LPStruct, or Currency).Invalid managed/unmanaged type combination (the Guid class must be paired with Struct or LPStruct).Invalid managed/unmanaged type combination (the DateTime class must be paired with Struct).Invalid managed/unmanaged type combination (Arrays can only be marshaled as LPArray or ByValArray).There is no marshaling support for this type.Object type must be __ComObject or derived from __ComObject.Source object cannot be converted to the destination type since it does not support all the required interfaces.Pointers cannot reference managed objects. Use ByRef instead.Pointers cannot reference marshaled structures. Use ByRef instead.This type can only be marshaled in restricted ways.Ansi char arrays cannot be marshaled as ByRef or as unmanaged-to-managed parameters.AsAny cannot be used on return types, ByRef parameters, ArrayWithOffset, or parameters passed from unmanaged to managed.VBByRefStr can only be used in combination with in/out, ByRef managed-to-unmanaged strings.ArrayWithOffsets can only be marshaled as inout, non-ByRef, managed-to-unmanaged parameters.Internal error.Classes with copy-ctors can only be marshaled non-ByRef.ArgIterators cannot be marshaled ByRef.HandleRefs cannot be marshaled ByRef or from unmanaged to managed.AppDomain cannot be unloaded during object finalization.AppDomain cannot be unloaded because the thread '%1' cannot be unwound out of it.Reached the end of the file.File has not been opened.Buffer is shorter than requested bytes.File name was not supplied.Undefined seek modifier.Type '%1' cannot be marshaled as an unmanaged structure; no meaningful size or offset can be computed.Warning: A StringBuilder buffer has been overflowed by unmanaged code. The process may become unstable. Insufficient capacity allocated to the StringBuilder before marshaling it.Hash validation failed for file or assembly '%1'.Could not load type '%1' because the module containing it from assembly '%2' failed to load.Could not load type '%1' from assembly '%2' because the format is invalid.Could not create array type '%1' from assembly '%2'.No server registered or could not load class for CLSID %1.Could not load type '%1' from assembly '%2' because the method '%3' could not be loaded.Method '%3' in type '%1' from assembly '%2' cannot be a static and a virtual.Derived method '%3' in type '%1' from assembly '%2' cannot reduce access.Could not get PINVOKE information for method '%3' in type '%1' from assembly '%2'.Array of type '%1' from assembly '%2' cannot be created because base value type is too large.Method '%3' in type '%1' from assembly '%2' does not have an implementation.Could not load type '%1' from assembly '%2' because the parent does not exist.Could not load type '%1' from assembly '%2' because the parent type is an interface.Could not load interface '%1' from assembly '%2' because it must extend from Object.Could not load type '%1' from assembly '%2' because the interface does not exist.Could not load type '%1' from assembly '%2' because it attempts to implement a class as an interface.Could not load the value type '%1' from assembly '%2' because it has an instance field of itself.Could not load type '%1' from assembly '%2' because generic types cannot have explicit layout.Type name '%1' from assembly '%2' is invalid.'%1' from assembly '%2' has too many dimensions.Managed method '%3' on type '%1' from assembly '%2' is not supported.Native method '%3' on type '%1' from assembly '%2' is not supported.Type '%1' from assembly '%2' does not have sufficient permission to override super type methods.Could not load type '%1' from assembly '%2' because its enclosing type is not specified with a type definition.Could not load type '%1' from assembly '%2' because it contains an object field at offset %3 that is incorrectly aligned or overlapped by a non-object field.Could not load type '%1' from assembly '%2' because the parent type is sealed.Type '%1' from assembly '%2' has a method with no name.Private method '%3' on type '%1' from assembly '%2' cannot be virtual.Constructor '%3' on type '%1' from assembly '%2' does not have the correct name or signature.Method override '%3' on type '%1' from assembly '%2' cannot find a method to replace.Method '%3' on type '%1' from assembly '%2' is overriding a method that has been overridden.Method '%3' on type '%1' from assembly '%2' is overriding a method that is not visible from that assembly.Method '%3' on type '%1' from assembly '%2' is overriding a method impl.Method '%3' on type '%1' from assembly '%2' tried to override a method with a different signature.Type '%1' from assembly '%2' tried to override method '%3' but does not implement or inherit that method.Method '%3' on type '%1' from assembly '%2' tried to implement a method declaration with a different virtual state.Method '%3' on type '%1' from assembly '%2' must be virtual to implement a method on an interface or super type.Could not load type '%1' from assembly '%2' because the method '%3' has no implementation (no RVA).Size of field of type '%1' from assembly '%2' is too large.Cannot connect to URL for '%1'.Type '%1' from assembly '%2' cannot extend from any other type.Type '%1' from assembly '%2' has zero size.Could not load TypeSpec from assembly '%2'.Type '%1' from assembly '%2' has a field of an illegal type.Body referenced in a method implementation must be defined in the same type. Type: '%1'. Assembly: '%2'.Body referenced in a method implementation cannot be static. Type: '%1'. Assembly: '%2'.Body token used in a method implementation is out of range. Type: '%1'. Assembly: '%2'.Declaration token used in a method implementation is out of range. Type: '%1'. Assembly: '%2'.Declaration referenced in a method implementation cannot be on a sealed type. Type: '%1'. Assembly: '%2'.Declaration referenced in a method implementation cannot be a final method. Type: '%1'. Assembly: '%2'.Declaration referenced in a method implementation must be a virtual method. Type: '%1'. Assembly: '%2'.Signature of the body and declaration in a method implementation do not match. Type: '%1'. Assembly: '%2'.Signature for the body in a method implementation cannot be found. Type: '%1'. Assembly: '%2'.Signature for the declaration in a method implementation cannot be found. Type: '%1'. Assembly: '%2'.Could not load type '%1' because the assembly containing it failed to load.Could not load type '%1' from assembly '%2' because objects overlapped at offset %3 and the assembly must be verifiable.Configuration error.Could not load type '%1' from assembly '%2'. Internal limitation: Too many generic arguments.PInvoke method not permitted on type '%1' from collectible assembly '%2'.Collectible type '%1' may not have Thread or Context static members.CLR error: %lx. The program will now terminate.Fatal errorAn invalid VARIANT has been passed as argument %i of method '%s' of type '%s'. If this argument is meant to be an interface pointer, add [MarshalAs(UnmanagedType.Interface)] to the managed definition of the argument. Click CANCEL to break into the debugger and OK to continue.Invalid VARIANT.Warning: Components of the Common Language Runtime debugging services are from different builds. Continuing to run will cause unpredictable results. In-process component (mscoree.dll) is version %d.%d (%s) Out-of-process component (mscordbi.dll) is version %d.%d (%s). .Application ErrorNo debugger found.Application has generated an exception that could not be handled. Process ID=0x%x (%d), Thread ID=0x%x (%d). Click OK to terminate the application. Click CANCEL to debug the application.INTERNAL ERROR: Unhandled exception in Debugger::HandleIPCEvent. Event ID=0x%x. Exception code=0x%08x, Eip=0x%08x. Process ID=0x%x (%d), Thread ID=0x%x (%d). Performance Monitor Extension DLL for CLR. This can only be used on Windows NT.Could not load on non-Windows NT system.Application has encountered a user-defined breakpoint. Process ID=0x%x (%d), Thread ID=0x%x (%d). Click ABORT to terminate the application. Click RETRY to debug the application. Click IGNORE to ignore the breakpoint.AppDomain cannot be unloaded because it is not local to the current process.Illegal attempt to replace or redimension a fixed or locked SafeArray.Invalid unmanaged calling convention: must be one of stdcall, cdecl, or thiscall.Type could not be marshaled because an embedded valuetype has no layout information.Could not load type '%1' from assembly '%2' because field '%3' was not given an explicit offset.Type could not be marshaled because an embedded string could not be converted from Unicode to ANSI.Type could not be marshaled because the length of an embedded array instance does not match the declared length in the layout.Failure converting Unicode string to ANSI.Failure converting ANSI string to Unicode.There is no marshaling support for nested arrays.Failure decoding embedded permission set object.Mscorlib.dll is missing types required by security.The list of COM source interfaces for type '%1' contains non interface or generic type '%2'.Object cannot be coerced to the original type of the ByRef VARIANT it was obtained from.The new wrapper type must have an empty constructor.Standard DISPID member name is formed incorrectly. The name must be in the following format: [DISPID=XXX].COM target does not implement IDispatch.All named parameters must be specified as [DISPID=XXX] when invoking on a standard members specified as [DISPID=XXX}.Variant returned from an Invoke call with a DISPID of -4 does not contain a valid IUnknown pointer.COM object that has been separated from its underlying RCW cannot be used. The COM object was released while it was still in use on another thread.COM object that has been separated from its underlying RCW cannot be used.Function can only be called from inside the class constructor of a class derived from a COM imported class.Base type has already registered a type creation callback.Invalid PInvoke or UnmanagedFunctionPointer calling convention.Unable to cast object of type '%1' to type '%2'.Object contains non-primitive or non-blittable data.Field passed in is not a marshaled member of the type '%1'.Requested range extends past the end of the array.Object type cannot be pinned.ArrayWithOffset: offset exceeds array size.Ran out of internal resource while executing marshaling operation. Possible cause: overly complex method signature.A call to GetInstance() for custom marshaler '%1' returned null, which is not allowed.Array size control parameter index is out of range.Array size control parameter type not supported.Multiple permission sets specified with the same SecurityAction.SafeArray cannot be marshaled to this array type because it has either nonzero lower bounds or more than one dimension.Type of the VARIANT specified for a parameter with a custom marshaler is not supported by the custom marshaler.Types extending from COM objects should override all methods of an interface implemented by the base COM class.Error loading file '%s'. %s.Error 0x%08x. %s.Error: %s.Unknown import key operation specified.Retrieving the COM class factory for component with CLSID %2 failed due to the following error: %1 %3.StrongName APIs could not locate a matching CSP for assembly '%1'.Field not found: '%1'.Method not found: '%1'.The interface does not support late bound calls since it does not derive from IDispatch.MSCOREE is not loaded.Missing entrypoint in MSCOREE: '%1'.Unhandled Exception:Cannot print exception string because Exception.ToString() failed.Could not load the structure '%1' from assembly '%2'. The structure is marked as eligible for type equivalence, but it has a method.Could not load the structure '%1' from assembly '%2'. The structure is marked as eligible for type equivalence, but it has a static or non-public field.[HRESULT 0x%08X][offset 0x%08X][opcode %s][operand 0x%08X][token 0x%08X][exception #0x%08X][stack slot 0x%08X][local variable #0x%08X][argument #0x%08x][found %s][expected %s][local variable '%s']Unknown opcode [0x%08X].Unknown calling convention [0x%08X].Unknown ELEMENT_TYPE [0x%08x].[return sig][field sig]Protected method access through an open instance delegate is not verifiable.Stack is too large.Array name is too long.fall through end of the method without returning.try start >= try end.try end > code size.handler start >= handler end.handler end > code size.Try starts in the middle of an instruction.Handler starts in the middle of an instruction.Try block overlap with another block.Try and filter/handler blocks are equivalent.Shared try has finally or fault handler.Handler block overlaps with another block.Handler block is the same as another block.Filter block overlaps with another block.Filter block is the same as another block.Filter contains try.Filter contains handler.Nested filters.filter >= code size.Filter starts in the middle of an instruction.fallthru the end of an exception block.fallthru into an exception handler.fallthru into an exception filter.Leave from outside a try or catch block.Rethrow from outside a catch handler.Endfinally from outside a finally handler.Endfilter from outside an exception filter block.Missing Endfilter.Branch into try block.Branch into exception handler block.Branch into exception filter block.Branch out of try block.Branch out of exception handler block.Branch out of exception filter block.Branch out of finally block.Return out of try block.Return out of exception handler block.Return out of exception filter block.jmp / exception into the middle of an instruction.Non-compatible types depending on path.Init state for this differs depending on path.Non-compatible types on stack depending on path.Stack depth differs depending on path.Instance variable (this) missing.Uninitialized this on entering a try block.Store into this when it is uninitialized.Return from .ctor when this is uninitialized.Return from .ctor before all fields are initialized.Branch back when this is uninitialized.ldftn/ldvirtftn not allowed on .ctor.Non-compatible types on the stack.Unexpected type on the stack.Missing stack slot for exception.Stack overflow.Stack underflow.Stack empty.Uninitialized item on stack.Expected I, I4, or I8 on the stack.Expected R, R4, or R8 on the stack.unexpected R, R4, R8, or I8 on the stack.Expected numeric type on the stack.Expected an ObjRef on the stack.Expected address of an ObjRef on the stack.Expected ByRef on the stack.Expected pointer to function on the stack.Expected single dimension array on the stack.Expected value type instance on the stack.Expected address of value type on the stack.Unexpected value type instance on the stack.Local variable is unusable at this point.Unrecognized local variable number.Unrecognized argument number.Unable to resolve token.Unable to resolve type of the token.Expected memberRef, memberDef or methodSpec token.Expected memberRef or fieldDef token.Expected signature token.Instruction cannot be verified.Operand does not point to a valid string ref.Return type is ByRef, TypedReference, ArgHandle, or ArgIterator.Stack must be empty on return from a void function.Return value missing on the stack.Stack must contain only the return value.Return uninitialized data.Illegal array access.Store non Object type into Object array.Expected single-dimension zero-based array.Expected single dimension array of pointer types.Array field access is denied.Allowed only in vararg methods.Value type expected.Method is not visible.Field is not visible.Item is unusable at this point.Expected static field.Expected non-static field.Address of not allowed for this item.Address of not allowed for ByRef.Address of not allowed for literal field.Cannot change initonly field outside its .ctor.Cannot throw this object.Callvirt on a value type method.Call signature mismatch.Static function expected..ctor expected.Cannot use callvirt on .ctor.Only super::ctor or typeof(this)::ctor allowed here.Possible call to .ctor more than once.Unrecognized signature.Cannot resolve Array type.Array of ELEMENT_TYPE_PTR.Array of ELEMENT_TYPE_BYREF or ELEMENT_TYPE_TYPEDBYREF.ELEMENT_TYPE_PTR cannot be verified.Unexpected vararg.Unexpected Void.ByRef of ByRefCode size is zero.Unrecognized use of vararg.Missing call/callvirt/calli.Cannot pass ByRef to a tail call.Missing ret.Void ret type expected for tail call.Tail call return type not compatible.Stack not empty after tail call.Method ends in the middle of an instruction.Branch out of the method.Finally handler blocks overlap.Lexical nesting.Missing ldsfld, stsfld, ldind, stind, ldfld, stfld, ldobj, stobj, initblk, or cpblk.Missing ldind, stind, ldfld, stfld, ldobj, stobj, initblk, cpblk.Innermost exception blocks should be declared first.Calli not allowed on virtual methods.Call not allowed on abstract methods.Unexpected array type on the stack.Value type with NotInGCHeap attribute being created on the GC heap.Attempt to enter a try block with nonempty stack.Unrecognized arguments for delegate .ctor.Delegate .ctor not allowed at the start of a basic block when the function pointer argument is a virtual method.Dup, ldvirtftn, newobj delegate::.ctor() pattern expected (in the same basic block).Ldftn or ldvirtftn instruction required before call to a delegate .ctor.Attempt to load address of an abstract method.ELEMENT_TYPE_CLASS ValueClass in signature.ELEMENT_TYPE_VALUETYPE non-ValueClass in signature.Box operation on TypedReference, ArgHandle, or ArgIterator.ByRef of TypedReference, ArgHandle, or ArgIterator.Array of TypedReference, ArgHandle, or ArgIterator.Stack not empty when leaving an exception filter.Unrecognized delegate .ctor signature; expected I.Unrecognized delegate .ctor signature; expected Object.Mkrefany on TypedReference, ArgHandle, or ArgIterator.Value type not allowed as catch type.ByRef not allowed as catch type.filter block should immediately precede handler blockldvirtftn on staticcallvirt on staticinitlocals must be set for verifiable methods with one or more local variables.branch/leave to the beginning of a catch/filter handlercall to .ctor only allowed to initialize this pointer from within a .ctor. Try newobj.Value type, ObjRef type or variable type expected.Expected address of value type, ObjRef type or variable type on the stack.Unrecognized type parameter of enclosing class.Unrecognized type parameter of enclosing method.Unrecognized type argument of referenced class instantiation.Unrecognized type argument of referenced method instantiation.Cannot resolve generic type.Method instantiation contains non boxable type arguments.Method parent instantiation contains non boxable type arguments.Field parent instantiation contains non boxable type arguments.Unrecognized calling convention for an instantiated generic method.Unrecognized generic method in method instantiation.Missing ldelema or call following readonly prefix.Missing callvirt following constrained prefix.Method parent has circular class type parameter constraints.Method has circular method type parameter constraints.Method instantiation has unsatisfied method type parameter constraints.Method parent instantiation has unsatisfied class type parameter constraints.Field parent instantiation has unsatisfied class type parameter constraints.Type operand of box instruction has unsatisfied class type parameter constraints.The 'this' argument to a constrained call must have ByRef type.The operand to a constrained prefix instruction must be a type parameter.The readonly prefix may only be applied to calls to array methods returning ByRefs.Illegal write to readonly ByRef.A readonly ByRef cannot be used with mkrefany.Alignment specified for 'unaligned' prefix must be 1, 2, or 4.The tail.call (or calli or callvirt) instruction cannot be used to transfer control out of a try, filter, catch, or finally block.Stack height at all points must be determinable in a single forward scan of IL.Call to base type of valuetype.Cannot construct an instance of abstract class.Unmanaged pointers are not a verifiable type.Cannot LDFTN a non-final virtual method for delegate creation if target object is potentially not the same type as the method class.Accessing type with overlapping fields.The 'this' parameter to the call must be the calling method's 'this' parameter.Expected I4 on the stack.Unverifiable PE Header/native stub.Unrecognized metadata, unable to verify IL.Unrecognized appdomain pointer.Type load failed.Module load failed.Cannot modify an imaged based (RVA) staticA call to PInvoke function '%1$s' has unbalanced the stack. This is likely because the managed PInvoke signature does not match the unmanaged target signature. Check that the calling convention and parameters of the PInvoke signature match the target unmanaged signature.The '%1$s' configuration file is invalid.A callback was made on a garbage collected delegate of type '%1$s'. This may cause application crashes, corruption and data loss. When passing delegates to unmanaged code, they must be kept alive by the managed application until it is guaranteed that they will never be called.An attempt was made to change the apartment state of the thread to %1$s, but it has already been set to %2$s. When creating a new thread the apartment state shouldbe set before the thread is started. For the main thread of the application, the apartmentstate can be set by specifying either [STAThreadAttribute] or [MTAThreadAttribute] on themain method of the application. If the application really needs to attempt to set the apartment state on a running thread, Thread.TrySetApartmentState should be used and the return value should be consulted to determine if the operation was successful. Note that Thread.TrySetApartmentState will not fire the InvalidApartmentStateChange MDA.The current thread used to have an apartment state of %1$s, but the application has CoUnitialized this thread and it is now %2$s. This may cause calls on RuntimeCallableWrappers representing some COM components to fail and may also cause COM component that are not multi-threaded to be accessed from multiple threads at the same time which can cause corruption or data loss.Attempting managed execution inside OS Loader lock. Do not attempt to run managed code inside a DllMain or image initialization function since doing so can cause the application to hang.An exception was caught but handled while releasing a COM interface pointer through Marshal.Release, Marshal.ReleaseComObject or implicitly after the corresponding RuntimeCallableWrapper was garbage collected. This is the result of a user refcount error or other problem with a COM object's Release. Make sure refcounts are managed properly. While these types of exceptions are caught by the CLR, they can still lead to corruption and data loss so if possible the issue causing the exception should be addressedAn invalid VARIANT was detected during a conversion from an unmanaged VARIANT to a managed object. Passing invalid VARIANTs to the CLR can cause unexpected exceptions, corruption or data loss.The call to QI for interface '%1$s' with IID '%2$s' failed with HRESULT 0x%3$s (%4$s). One likely reason this failed is that the object does not have a proxy/stub dll properly registered.Transition into COM context 0x%1$x for this RuntimeCallableWrapper failed with the following error: %2$s. This is typically because the COM context 0x%1$x where this RuntimeCallableWrapper was created has been disconnected or it is busy doing something else and cannot process the context transition. No proxy will be used to service the request on the COM component and calls will be made to the COM component directly. This may cause corruption or data loss. To avoid this problem, please ensure that all COM contexts/apartments/threads stay alive and are available for context transition, until the application is completely done with the RuntimeCallableWrappers that represents COM components that live inside them.Transition into COM context 0x%1$x for this RuntimeCallableWrapper failed with the following error: %2$s. This is typically because the COM context 0x%1$x where this RuntimeCallableWrapper was created has been disconnected or it is busy doing something else. Releasing the interfaces from the current COM context (COM context 0x%3$x). This may cause corruption or data loss. To avoid this problem, please ensure that all COM contexts/apartments/threads stay alive and are available for context transition, until the application is completely done with the RuntimeCallableWrappers that represents COM components that live inside them.A non marshalable COM component is being used from a different apartment/context then the one where it first entered the CLR. Since the component is non marshalable, it will be called directly from the current apartment/context. This may cause corruption or data loss if the component does not support being accessed from multiple threads at once. This is most likely caused by a faulty IMarshal implementation on the part of the COM component.An invalid IUnknown* was detected during a conversion from a COM component to a managed object. Passing invalid IUnknown pointers to the CLR can cause unexpected exceptions, corruption or data loss.Marshaling parameter with index %1$i and name '%2$s' from '%3$s' to '%4$s'Invalid function pointer 0x%1$x was passed into the runtime to be converted to a delegate. Passing in invalid function pointers to be converted to delegates can cause crashes, corruption or data loss. An early bound call (vtable call) was made on the following member of an auto dispatch class interface: '%1$s'. Early bound calls on members of auto dispatch class interfaces are not allowed. Please consider using an explicit interface as the default interface for the type. If a class interface must be called early bound, change it to auto dual. This can be accomplished by marking the class with the following attribute, located in the System.Runtime.InteropServices namespace: [ClassInterface(ClassInterfaceType.AutoDual)] Method '%1$s', while executing within a constrained execution region, makes a call at IL offset 0x%2$04X to '%3$s', which does not have a sufficiently strong reliability contract and might cause non-deterministic results.Method '%1$s', while executing within a constrained execution region, makes a call at IL offset 0x%2$04X to '%3$s', which is virtual and cannot be prepared automatically at compile time. The caller must ensure this method is prepared explicitly at runtime before entering the constrained execution region.Method '%1$s', which contains at least one constrained execution region, cannot be prepared automatically since it has one or more unbound generic type parameters. The caller must ensure this method is prepared explicitly at runtime prior to execution.Method '%1$s' calls RuntimeHelpers.PrepareConstrainedRegions() at IL offset 0x%2$04X. This is invalid since it does not coincide with the beginning of a try clause.The CLR marshaler encountered an error while attempting to restore the thread culture after a call from unmanaged to managed where an LCID was used to specify the culture for the call. This will cause the thread's culture to remain set to the one associated with the LCID. The cause of the failure was: %1$sThe CLR marshaler encountered an error while attempting to release the reference to a SafeHandle it acquired in order to marshal the SafeHandle to an unmanaged pointer during a call from managed to unmanaged. This may cause the unmanaged resource the SafeHandle represents to be leaked. The cause of the failure was: %1$sThe CLR marshaler encountered an error while attempting to associate a SafeHandle with an unmanaged resource. This may cause the unmanaged resource to be leaked. The cause of the failure was: %1$sAn exception was thrown from the CleanupNativeData method of a custom marshaler of type '%1$s'. This may cause an unmanaged data leak and should be corrected if possible. The cause of the failure was: %1$sA SafeHandle or CriticalHandle of type '%1$s' failed to properly release the handle with value 0x%2$p. This usually indicates that the handle was released incorrectly via another means (such as extracting the handle using DangerousGetHandle and closing it directly or building another SafeHandle around it.)Function DllMain, called with reason DLL_PROCESS_ATTACH, returned FALSE. DLL initialization failed. To ignore the DllMain return, set Registry value HKEY_LOCAL_MACHINE\Software\Microsoft\.NETFramework\IgnoreDllMainReturn to 1Reflection has created a memberInfo cache.User code running on thread %1$i has attempted to abort thread %2$i. This may result in a corrupt state or resource leaks if the thread being aborted was in the middle of an operation that modifies global state or uses native resources. Aborting threads other than the currently running thread is strongly discouraged.The assembly named '%1$s' was loaded from '%2$s' using the LoadFrom context. The use of this context can result in unexpected behavior for serialization, casting and dependency resolution. In almost all cases, it is recommended that the LoadFrom context be avoided. This can be done by installing assemblies in the Global Assembly Cache or in the ApplicationBase directory and using Assembly.Load when explicitly loading assemblies.The CLR has been unable to transition from COM context 0x%1$x to COM context 0x%2$x for 60 seconds. The thread that owns the destination context/apartment is most likely either doing a non pumping wait or processing a very long running operation without pumping Windows messages. This situation generally has a negative performance impact and may even lead to the application becoming non responsive or memory usage accumulating continually over time. To avoid this problem, all single threaded apartment (STA) threads should use pumping wait primitives (such as CoWaitForMultipleHandles) and routinely pump messages during long running operations.An attempt has been made to free an RCW that is in use. The RCW is in use on the active thread or another thread. Attempting to free an in-use RCW can cause corruption or data loss.A UTC DateTime is being converted to text in a format that is only correct for local times. This can happen when calling DateTime.ToString using the 'z' format specifier, which will include a local time zone offset in the output. In that case, either use the 'Z' format specifier, which designates a UTC time, or use the 'o' format string, which is the recommended way to persist a DateTime in text. This can also occur when passing a DateTime to be serialized by XmlConvert or DataSet. If using XmlConvert.ToString, pass in XmlDateTimeSerializationMode.RoundtripKind to serialize correctly. If using DataSet, set the DateTimeMode on the DataColumn object to DataSetDateTime.Utc. The following error occurred while determining how to marshal the parameters of member '%1$s' of type '%2$s': %3$s This is most likely due to an incompatible MarshalAs attribute on one of the parameters. A COM client has called managed method '%1$s' on type '%2$s'. This method does not have an HRESULT return type and an exception was thrown that was not handled. The exception contains the following message: %3$s. This exception will be caught and zero will be returned to the COM caller if the method's return type is not void.Attempting to call into managed code without transitioning out first. Do not attempt to run managed code inside low-level native extensibility points, such as the vectored exception handler, since doing so can cause corruption and data loss.A QueryInterface call was made requesting the class interface of COM visible managed class '%1$s'. However since this class derives from non COM visible class '%2$s', the QueryInterface call will fail. This is done to prevent the non COM visible base class from being constrained by the COM versioning rules.A QueryInterface call was made requesting the default IDispatch interface of COM visible managed class '%1$s'. However since this class does not have an explicit default interface and derives from non COM visible class '%2$s', the QueryInterface call will fail. This is done to prevent the non COM visible base class from being constrained by the COM versioning rules.The assembly with display name '%1$s' loaded from code base '%2$s' failed to load in the '%3$s' binding context of the AppDomain with ID %4$d. The cause of the failure was: %5$sAn attempt was made to retrieve a GCHandle from an invalid IntPtr cookie (0x%1$x). The cookie was most likely invalid because the cookie does not represent a GCHandle, the GCHandle has already been freed, the retrieval was attempted in the wrong AppDomain, or the GCHandle was marshaled to native code as a GCHandle but passed back into managed code as an IntPtr where a cast was attempted. Attempting to use an invalid pointer to reclaim a GC handle can cause unexpected exceptions, crashes, corruption or data loss. An exception was caught but handled while releasing a COM interface pointer through Marshal.Release or Marshal.ReleaseComObject or implicitly after the corresponding RuntimeCallableWrapper was garbage collected. This is the result of a user refcount error or other problem with a COM object's Release. Make sure refcounts are managed properly. The COM interface pointer's original vtable pointer was 0x%1$x. While these types of exceptions are caught by the CLR, they can still lead to corruption and data loss so if possible the issue causing the exception should be addressedThe first PInvoke call to export '%1$s' in module '%2$s' has been made.The runtime has encountered a fatal error. The address of the error was at 0x%1$08x, on thread 0x%2$x. The error code is 0x%3$08x. This error may be a bug in the CLR or in the unsafe or non-verifiable portions of user code. Common sources of this bug include user marshaling errors for COM-interop or PInvoke, which may corrupt the stack.User code has attempted to call the following API: '%1$s'. This may result in a deadlock in the process.An overlapped pointer (0x%1$p) that was not allocated on the GC heap was passed via PInvoke to the Win32 function '%2$s' in module '%3$s'. If the AppDomain is shut down, this can cause heap corruption when the async I/O completes. The best solution is to pass a NativeOverlapped structure retrieved from a call to System.Threading.Overlapped.Pack(). If the AppDomain exits, the CLR will keep this structure alive and pinned until the I/O completes.An overlapped pointer (0x%1$p) may have been freed before the I/O operation completed. Freeing an overlapped pointer before the I/O operation completes will cause GC heap corruption when the I/O does complete. Note that this MDA may not represent an error if the overlapped operation did not start successfullyThe native component calling into the CLR through this ComCallWrapper has performed an illegal cast on this IUnknown or IDispatch pointer. The caller neglected to call QueryInterface for the correct interface before making this call.A thread has entered fiber mode and therefore debugging must be stopped.The assembly loaded from code base '%1$s' failed to load in the '%2$s' binding context of the AppDomain with ID %3$d. The cause of the failure was: %4$sThe assembly with display name '%1$s' failed to load in the '%2$s' binding context of the AppDomain with ID %3$d. The cause of the failure was: %4$sMarshaling field '%1$s' from '%2$s' to '%3$s'return valueDLL '%1$s' is attempting managed execution inside OS Loader lock. Do not attempt to run managed code inside a DllMain or image initialization function since doing so can cause the application to hang.%1$s Managed Debugging AssistantCannot use SizeParamIndex for ByRef array parameters.This object cannot be marshaled as an IDispatch.Internal limitation: method signature is too complex or too large.Internal limitation: structure is too complex or too large.Array size exceeds addressing limitations.Struct or class fields cannot be of type StringBuilder. The same effect can usually be achieved by using a String field and preinitializing it to a string with length matching the length of the appropriate buffer.Thread has not been started.An instance of the __ComObject type cannot be created unless the type has been obtained using GetTypeFromProgID or GetTypeFromCLSID.Marshaler restriction: Excessively long string.The declaration referenced in a method implementation is inaccessible. Type: '%1' Assembly: '%2'Vararg calling convention not supported.Invalid custom attribute provided.Invalid custom attribute provided: '%1'Thread is running or terminated; it cannot restart.Unable to cast transparent proxy to type '%1'.The current thread has been chosen as a deadlock victim.Unable to retrieve thread information.Thread is not running; it cannot be suspended.Thread is not running; it cannot be resumed.Thread is not user-suspended; it cannot be resumed.Thread is dead; priority cannot be accessed.Thread is dead; state cannot be accessed.Thread in invalid state.Thread is suspended; attempting to abort.PInvoke restriction: cannot return variants.Connection timeout for URL '%1'.The path contains illegal characters.The path is not of a legal form.Illegal layout for type '%1' from assembly '%2': valuetypes with non-public fields may not overlap with other fields.Lookup of token information timed out.Specified SAFEARRAY is invalid.Method '%1' of COM event interface '%2' is not present on event provider '%3'.Methods on COM event interfaces must take a single delegate derived class as a parameter and have a void return type.Strong name validation failed for assembly '%s'. The file may have been tampered with or it was delay signed, but not fully signed with the correct private key.Strong name validation failed.Invalid delegate layout.The Common Language Runtime could not run the given program.Could not run the given program. _CorExeMain failed.The UNC path should be of the form \\server\share.Custom marshaler '%1' does not implement the ICustomMarshaler interface.Custom marshaler '%1' does not implement a static GetInstance method that takes a single string parameter and returns an ICustomMarshaler.Custom marshalers are only allowed on classes, strings, arrays, and boxed value types.COM import type '%1' from assembly '%2' cannot have layout information.Type '%1' has an invalid default COM interface: '%2'.Type '%1' does not support the specified default COM interface: '%2'Type '%1' that has the requested GUID is not a value class.The specified record cannot be mapped to a managed value class.Cannot marshal: Encountered unmappable character.Invalid marshaling metadata.SafeHandles cannot be marshaled from unmanaged to managed.Ref and out SafeHandle parameters cannot be abstract.SafeHandles cannot be returned from managed to unmanaged.Invalid managed/unmanaged type combination (SafeHandles must not have a MarshalAs attribute set and cannot be used in arrays).Safe handle has been closedSafe handle's handle field can only be set if the safe handle is not closed and has a ref count of 1.Structures containing SafeHandle fields are not allowed in this operation.SafeHandle fields cannot be created from an unmanaged handle.Failure decoding embedded permission set collection object.Returned SafeHandles cannot be abstract.SafeHandle subclasses may not override the finalizer. Put logic in ReleaseHandle instead.SafeHandle derived types cannot be stored in Variants.Invalid managed/unmanaged type combination (System.Array must be paired with SafeArray or Interface).VariantWrappers cannot be stored in Variants.The structure contains fields that are not supported in unmanaged records.The generic type '%1' was used with the wrong number of generic arguments in assembly '%2'.A method in the type '%1' from assembly '%2' was used with the wrong number of generic arguments.Could not load type '%1' from assembly '%2' because field '%3' was given a negative offset.Unable to set thread priority.Type '%1' in assembly '%2' is not marked as serializable.The constructor to deserialize an object of type '%1' was not found.Member '%1' in class '%2' is not present in the serialized stream and is not marked with System.Runtime.Serialization.OptionalFieldAttribute.Possible version mismatch. Field '%1' in class '%2' has mismatched types.Not all delayed fixup objects could be resolved. Such objects could be cyclic IObjectReferences, IObjectReferences that return other IObjectReferences too many times (i.e. objects with too long an IObjectReference chain) or nested valuetypes.Type is not resolved for member '%1,%2'.Object '%1' has been disconnected or does not exist at the server.The method '%1' was not found on type '%2'.Paths starting with \\?\GlobalRoot are internal to the kernel and should not be opened by managed applications.The generic type '%1' was used with an invalid instantiation in assembly '%2'.The length for ByValTStr strings cannot be zero.Error formatting message.[IL]: Error: [mdToken=0x%x]The server or proxy was not found for '%1'.Code execution is prohibited in an assembly loaded as ReflectionOnly.CriticalHandles cannot be marshaled from unmanaged to managed.Ref and out CriticalHandle parameters cannot be abstract.Invalid managed/unmanaged type combination (CriticalHandles must not have a MarshalAs attribute set and cannot be used in arrays).Critical handle has been closedStructures containing CriticalHandle fields are not allowed in this operation.CriticalHandle fields cannot be created from an unmanaged handle.Returned CriticalHandles cannot be abstract.CriticalHandle derived types cannot be stored in Variants.CriticalHandle subclasses may not override the finalizer. Put logic in ReleaseHandle instead.AssemblyResolveEvent handlers cannot return Assemblies loaded for reflection only.ReflectionOnlyAssemblyResolve handlers must return Assemblies loaded for reflection only.Method '%3' on type '%1' from assembly '%2' tried to implicitly override a method with weaker type parameter constraints.Method '%3' on type '%1' from assembly '%2' tried to implicitly implement an interface method with weaker type parameter constraints.Method '%3' on type '%1' from assembly '%2' tried to explicitly implement a local method with weaker type parameter constraints.Method '%3' on type '%1' from assembly '%2' tried to explicitly implement a parent method with weaker type parameter constraints.Method '%3' on type '%1' from assembly '%2' tried to explicitly implement an interface method with weaker type parameter constraints.A circular dependency was detected when loading file or assembly '%1'.Invalid PInvoke calling convention. Vararg functions must use the cdecl calling convention.Type '%1' in assembly '%2' cannot be persisted into the native image.Explicit assembly name must be specified when loading a type as ReflectionOnlyModuleResolveEvent returned an incompatible Module. ReflectionOnly assemblies cannot bind to normal Modules, nor vice-versa.Could not load type '%1' from assembly '%2' because a covariant or contravariant type parameter was used illegally in the signature for an argument in method '%3'.Could not load type '%1' from assembly '%2' because a covariant or contravariant type parameter was used illegally in the signature for the result type in method '%3'.Could not load type '%1' from assembly '%2' because a covariant or contravariant type parameter was used illegally in an inherited interface.Could not load type '%1' from assembly '%2' because a covariant or contravariant type parameter was used illegally in a type parameter constraint in method '%3'.Could not load type '%1' from assembly '%2' because it declares a covariant or contravariant type parameter and is not an interface or delegate.Could not load type '%1' from assembly '%2' because it uses an illegal variance annotation on a type parameter.The type '%1' in assembly '%2' has a contracting interface set for some instantiationsAttempted to load a 64-bit assembly on a 32-bit platform.Configuration parser errorError parsing %s Parser returned error 0x%08X.Type names passed to Assembly.GetType() must not specify an assembly.Mixed mode assembly is built against version '%1' of the runtime and cannot be loaded in the %2 runtime without additional configuration information.Unexpected assembly-qualifier in a typename.Typename needs an assembly qualifier.Could not load file or assembly '%1'. %2Signature is not Interop compatible.Invalid managed/unmanaged type combination (String[] must be paired with an ArraySubType of LPStr, LPWStr, or LPTStr).Invalid managed/unmanaged type combination (Object[] or System.Array must be paired with an ArraySubType of Struct, Interface, IUnknown or IDispatch).Invalid managed/unmanaged type combination (DateTime[] must be paired with an ArraySubType of Struct).Invalid managed/unmanaged type combination (Decimal[] must be paired with an ArraySubType of Struct).Invalid managed/unmanaged type combination (Arrays of SafeHandles are not supported).Invalid managed/unmanaged type combination (Arrays of CriticalHandles are not supported).Invalid SafeArraySubType/managed element type combination.Cannot marshal field '%2' of type '%1': %3Cannot marshal '%1': %2ISerializable type '%1' tried to deserialize itself as type '%2' which is an invalid type.API restriction: The assembly '%1' has already loaded from a different location. It cannot be loaded from a new location within the same appdomain.Cannot resolve dependency to assembly '%1' because it has not been preloaded. When using the ReflectionOnly APIs, dependent assemblies must be pre-loaded or loaded on demand through the ReflectionOnlyAssemblyResolve event.This type has a ComVisible(false) parent in its hierarchy, therefore QueryInterface calls for IDispatch or class interfaces are disallowed.Retrieving the COM class factory for remote component with CLSID %2 from machine %3 failed due to the following error: %1 %3.Creating an instance of the COM component with CLSID %2 from the IClassFactory failed due to the following error: %1 %3.Creating an instance of the licensed COM component with CLSID %2 from the IClassFactory failed due to the following error: %1 %3.Unable to cast COM object of type '%2' to interface type '%3'. This operation failed because the QueryInterface call on the COM component for the interface with IID '%4' failed due to the following error: %1.Unable to cast COM object of type '%2' to event interface type '%3'. This operation failed because the QueryInterface call on the COM component for the interface with IID '%4' failed due to the following error: '%1' and the COM component does not support the source interface with IID '%5'.Unable to cast COM object of type '%2' to interface type '%3'. This operation failed because the QueryInterface call on the COM component for the interface with IID '%4' failed due to the following error: '%1' and the COM component does not support IDispatch::Invoke calls for DISPID_NEWENUM.Unable to cast COM object of type '%2' to standard managed interface type '%3'. This operation failed because the QueryInterface call on the COM component for the managed interface with IID '%4' failed due to the following error: '%1' and the QueryInterface call for the native interface with IID '%5' that corresponds to this managed interface failed due to the following error: %6.Unable to cast COM object of type '%1' to class type '%2'. COM components that enter the CLR and do not support IProvideClassInfo or that do not have any interop assembly registered will be wrapped in the __ComObject type. Instances of this type cannot be cast to any other class; however they can be cast to interfaces as long as the underlying COM component supports QueryInterface calls for the IID of the interface.Unable to cast COM object of type '%1' to class type '%2'. Instances of types that represent COM components cannot be cast to types that do not represent COM components; however they can be cast to interfaces as long as the underlying COM component supports QueryInterface calls for the IID of the interface.Unable to cast COM object of type '%1' to class type '%2'. Instances of types that represent COM components cannot be cast to different types that represent COM components; however they can be cast to interfaces as long as the underlying COM component supports QueryInterface calls for the IID of the interface.%1Generic types cannot be marshaled.Thread was being aborted.Thread was interrupted from a waiting state.Insufficient memory to continue the execution of the program.Unable to load Jit Compiler: (%s): file may be missing or corrupt. Please check or rerun setup.Profiling failureGeneric types cannot be marshaled to COM interface pointers.Mixed mode assembly cannot be loaded into version '%1' of the runtime because it is already loaded into version '%2'.Method '%1' in ComImport class '%2' must implement an interface method.Insufficient memory within specified address space range to continue the execution of the program.Array dimensions exceeded supported range.%General_AppName% has encountered a user-defined breakpoint.A breakpoint in an application indicates a program error. After this dialog is dismissed, the application will continue running, but it may be in an unstable state.File '%1' was loaded in a passive domain in a manner that makes it unable to run.Cannot override runtime implemented method '%3' on type '%1' from assembly '%2'.'%1' has an incompatible metadata format. The assembly must be compiled using metadata format '%2'.Collectible type '%1' has unsupported FixedAddressValueTypeAttribute applied to a field.Could not load type '%1' from assembly '%2'. The type is marked as eligible for type equivalence, but either it has generic parameters, or it is not a structure, COM imported interface, enumeration, or delegate.Could not load type '%1' from assembly '%2'. The type is marked as eligible for type equivalence, but the containing assembly is not loaded as fully trusted.Could not load type '%1' from assembly '%2'. The type is marked as eligible for type equivalence, but it is not marked as public.Could not execute the method because either the method itself or the containing type is not fully instantiated.Could not load file or assembly '%1'. This assembly was compiled for a different processor.Creating an instance of the COM component with CLSID %2 using CoCreateInstanceFromApp failed due to the following error: %1 %3. Please make sure your COM object is in the allowed list of CoCreateInstanceFromApp.Cannot resolve dependency to Windows Runtime type '%1'. When using the ReflectionOnly APIs, dependent Windows Runtime assemblies must be resolved on demand through the ReflectionOnlyNamespaceResolve event.Could not find Windows Runtime type '%1'.To resolve a namespace from a custom Windows Runtime component, you must supply the packageGraphFilePaths argument to ResolveNamespace.Returning a .NET Framework assembly to resolve a Windows Runtime reference is not supported.Types from custom Windows Runtime components are not supported in desktop applications.Target-dependent SIMD vector types may not be used with ngen.SIMD intrinsics may not be used by partial trust applications.The generic type specified by the IBC data is not available to this assemblyThe generic method specified by the IBC data is not available to this assemblyHardware intrinsics may not be used with ngen.Method implementation on an interface '%1' from assembly '%2' must be a final method.Could not call method '%1' on interface '%2' with type '%3' from assembly '%4' because there are multiple incompatible interface methods overriding this method.Error: InterfaceImpl's implemented type (0x%08x) not marked tdInterface.Error: Field is marked HasRVA but has no RVA record.Error: Field is assigned zero RVA.Error: Method has both non-zero RVA and Implementation Map.Error: Extraneous bits in Flags (0x%08x).Error: TypeDef extends itself.Error: System.ValueType must extend System.Object.Warning: TypeDef extends TypeSpec (0x%08x), not supported in Version 1.Error: Value class has neither fields nor size parameter.Error: Interface is marked Sealed.Error: NestedClass token (0x%08x) in NestedClass record is not a valid TypeDef.Error: EnclosingClass token (0x%08x) in NestedClass record is not a valid TypeDef.Error: Duplicate NestedClass record (0x%08x).Error: Nested type token (0x%08x) has multiple EnclosingClass tokens (0x%08x, 0x%08x).Error: Zero RVA of field 0x%08x in FieldRVA record.Error: Invalid field token in FieldRVA record (field: 0x%08x; RVA: 0x%x).Error: Same RVA in another FieldRVA record (RVA: 0x%x; field: 0x%08x).Error: Same field in another FieldRVA record(field: 0x%08x; record: 0x%08x).Error: Invalid token specified as EntryPoint in CLR header.Error: Instance method token specified as EntryPoint in CLR header.Error: Invalid type of instance field(0x%08x) of an Enum.Error: Method has invalid RVA (0x%x).Error: Literal field has no const value.Error: Class implements interface but not method (class:0x%08x; interface:0x%08x; method:0x%08x).Error: CustomAttribute has invalid Parent token (0x%08x).Error: CustomAttribute has invalid Type token (0x%08x).Error: CustomAttribute has non-constructor Type (0x%08x).Error: CustomAttribute's Type (0x%08x) has invalid signature.Error: CustomAttribute's Type (0x%08x) has no signature.Error: CustomAttribute's blob has invalid prolog (0x%04x).Error: Method has invalid local signature token (0x%08x).Error: Method has invalid header.Error: EntryPoint method has invalid number of arguments, expecting %d.Error: EntryPoint method has invalid return type.Error: EntryPoint method has invalid argument number %d.Error: Illegal use of type 'void' in signature.Error: Multiple implementation of interface method (class:0x%08x; interface:0x%08x; method:0x%08x).Error: GenericParam has no name.Warning: GenericParam has nil owner.Error: GenericParam has a duplicate based on owner and name, token=0x%08x.Error: GenericParam has a duplicate based on owner and number, token=0x%08x.Error: GenericParam is out of sequence by owner.Error: GenericParam is out of sequence by number.Error: GenericParam is co-or-contra variant but its owner, token (0x%08x), is not an interface or delegate.Error: GenericParam is a method type parameter and must be non-variant, not co-or-contra variant.Error: GenericParam has invalid variance value in flags (0x%08x).Error: GenericParam has inconsistent special constraints ReferenceTypeConstraint and ValueTypeConstraint in flags (0x%08x).Error: GenericParamConstraint has nil owner.Error: GenericParamConstraint has a duplicate based on owner and constraint, token=0x%08x.Error: GenericParamConstraint is non-contiguous with preceding constraints for same owner, token=0x%08x.Error: MethodSpec has nil method.Error: MethodSpec has a duplicate based on method and instantiation, token=0x%08x.Error: MethodSpec signature has invalid calling convention=0x%08x.Error: MethodSpec signature is missing arity at byte=0x%08x.Error: MethodSpec signature is missing type argument # %d.Error: MethodSpec has generic method of arity %d but instantiation of different arity %d.Error: MethodSpec method is not generic.Error: Signature missing arity of instantiated generic type at byte=0x%08x.Error: Signature has generic type of arity %d instantiated at different arity %d at byte=0x%08x.Error: Method cannot be both generic and a class constructor.Error: Method cannot be both generic and an instance constructor.Error: Method cannot be both generic and defined on an imported type.Error: Method cannot be both generic and have non-default calling convention.Error: Entry point in CLR header is the token for a generic method.Error: Method signature is generic but is missing its arity at byte=0x%08x.Error: Method signature is generic but its arity is zero at byte=0x%08x.Error: Signature has generic type instantiated at arity 0 at byte=0x%08x.Error: MethodSpec signature has arity 0 at byte=0x%08x.Error: MethodDef signature has arity %d but the token owns %d GenericParams.Error: Entry point in CLR header is the token for a method in a generic type.Error: MethodImpl overrides non-generic method (token=0x%08x) with generic method.Error: MethodImpl overrides generic method (token=0x%08x) with non-generic method.Error: MethodImpl overrides generic method (token=0x%08x) of arity %d with generic method of arity %d.Error: TypeDef extends a TypeSpec (0x%08x) that is not an instantiated type.Error: Signature has type instantiated at ByRef at offset 0x%08x.Error: MethodSpec has type instantiated at ByRef at offset 0x%08x.Error: TypeSpec has empty signature.Error: TypeSpec has signature containing one or more sentinels.Error: TypeDef is generic but has explicit layout.Error: Signature has token following ELEMENT_TYPE_CLASS (_VALUETYPE) that is not a TypeDef or TypeRef (token: 0x%08x; offset: 0x%08x).Warning: Class does not implement interface method in this module (class:0x%08x; interface:0x%08x; method:0x%08x).CLR assembly '%s' was imported from a type library and cannot be re-exported to a type library. Make sure the type library from which the assembly was imported is registered.Internal error 0x%08x.Invalid file token.Invalid token type.Invalid entry point token.Invalid token.Invalid token in v-table fix-up table; use ildasm to find code generation error.Unable to get nested type properties.Method token out of range.Method name too long.Method name is not null terminated.Method in an Enum.Method with non-zero RVA in an Import.Abstract method with non-zero RVA.Runtime-implemented method with non-zero RVA.Internal call method with non_NULL RVA.Abstract method in non-abstract class.Non-virtual abstract method.Non-abstract, non-.cctor method in an interface.Virtual PInvoke implemented method.Virtual Static Method.Virtual Instance Constructor.Virtual Non-Abstract Interface Method.Nonvirtual Instance Interface Method.Synchronized Method in Value Type.Non-Static Global Method.Global Instance Constructor.Generic method or method in generic class is internal call, PInvoke, or is defined in a COM Import class.Generic method is marked runtime-implemented.Bad use of Runtime Impl attribute.Bad flags on delegate constructor.Unknown runtime implemented delegate method.Generic methods should always be mcInstantiated.Field token out of range.Invalid Field Access Flags.Field is Literal and InitOnly.Non-Static Global Field.Instance Field in an Interface.No Instance Field in an Enum.Non-virtual methods should not be searched.This method cannot be an Init Method.Managed native not presently supported.Bad implementation flags.Bad unmanaged code entry point.Generic code may not be varargs.Could not load type '%1' from assembly '%2' because it cannot inherit directly from the delegate class.Could not load type '%1' from assembly '%2' because delegate classes must be sealed.Enclosing type(s) not found for type '%1' in assembly '%2'.Illegal definition for runtime implemented delegate method.Missing definition for required runtime implemented delegate method.Duplicate type with name '%1' in assembly '%2'.Bad method token.Cannot get LinkRef.ECall methods must be packaged into a system module.Could not get classlayout.Signature is not IMAGE_CEE_CS_CALLCONV_LOCAL_SIG.Bad class token.Bad IL range.MethodDef without TypeDef as Parent.MethodSpec or MemberRef has parent with no members.Fields inside generic classes must be referenced using MemberRefs, even in the same module as the class.Invalid token saved in ManifestResource.Empty assembly simple name.Bad IL format.Could not load type '%1' from assembly '%2' due to value type mismatch.Method declaration is not a methoddef.Duplicate definition for runtime implemented delegate method.Ecalls must have a 0 RVA.The metadata is corrupt.The signature is incorrect.Full Name of Typeref is too long.Invalid Typeref token.The ClassInterface custom attribute is invalid.ClassInterface custom attribute does not have the right format.Illegal or unimplemented ELEM_TYPE in signature.Bad element type in SizeOf.Type '%1' in assembly '%2' has more than one method with the following custom attribute '%3'.Type '%1' in assembly '%2' has method '%3' with an incorrect signature for the serialization attribute that it is decorated with.Structures defined in untrusted code cannot be marshaled to and from native code as either parameters or return values.Type '%1' from assembly '%2' is attempting to implement an inaccessible interface.Malformed custom attribute header.Malformed custom attribute string.Bad string token.No string associated with token.Image has a platform-specific fixup type that is not compatible with this platform.Token specifying generic type must be either a typeref or typedef.Array rank may not be zero.Single-dimensional array rank must be one.ClassLayout has invalid PackingSize; valid set of values is {1,2,4,...,128}.Array type not expected here.Bad type visibility flag value.Family flag is not allowed on global functions.Could not find exported type in metadata.Expected array type.Generic member ref must be of type MethodDef or MemberRef.Expected interface.Metadata method count does not match method enumeration length for type '%1' from assembly '%2'.Metadata field count does not match field enumeration length for type '%1' from assembly '%2'.Type '%1' from assembly '%2' must be declared as a value type to be used as a value type.Type contains improperly formed type variance signature.Could not load type '%1' from assembly '%2' because it declares a field in a covariant type.Custom attributes that are TypeSpecs must be of type ELEMENT_TYPE_VALUETYPE or ELEMENT_TYPE_CLASS.An unexpected field signature was found.A valid typedef or typeref token is expected to follow a ELEMENT_TYPE_CLASS or ELEMENT_TYPE_VALUETYPE.A ELEMENT_TYPE_FNPTR cannot have a field signature.A ELEMENT_TYPE_FNPTR cannot be generic.A valid typedef or typeref token is expected to follow a ELEMENT_TYPE_GENERICINST.Only pointer to void allowed in function arguments.An ELEMENT_TYPE_TYPEDBYREF cannot have a ELEMENT_TYPE_BYREF modifier.Type '%1' in assembly '%2' has method '%3' which is either static, virtual, abstract or generic, but is marked as being a serialization callback method.Type '%1' from assembly '%2' contains an invalid method implementation signature.Internal limitation: too many property methods associated with this method.Internal limitation: too many fields.A library name must be specified in a DllImport attribute applied to non-IJW methods.Generic context-bound objects are not supported.Context-bound objects with generic methods are not supported.GenericArguments[%1], '%2', on '%3' violates the constraint of type parameter '%4'.Method %1.%2: type argument '%3' violates the constraint of type parameter '%4'.Type '%1' from assembly '%2' contains more methods than the current implementation allows.Enumerated types cannot have any generic type parameters, beyond any inherited from their enclosing type (for nested enums).DebuggerErrorIgnoring managed exception from unknown thread.Catch handler cannot precede try block.Could not load type '%1' from assembly '%2' because it has recursive generic definition.Illegal to load assemblies for ReflectionOnly in a verification domain.JIT Compiler encountered an internal limitation.The security object (Permission or PermissionSet) used for performing a Demand caused an error relating to serialization/deserialization.Type forwarding chain is too long or is recursive.Application: CoreCLR Version: Description: The process was terminated due to an unhandled exception.Exception Info: Description: The application requested process termination through System.Environment.FailFast(string message).Message: Description: The process was terminated due to an internal error in the .NET Runtime Description: The process was terminated due to stack overflow.Stack:at IP %1 (%2) with exit code %3.exception code %1, exception address %2The remainder of the message was truncated.Invalid managed/unmanaged type combination (Marshaling to and from COM VARIANTs isn't supported).Invalid managed/unmanaged type combination (Marshaling to and from COM interface pointers isn't supported).Invalid managed/unmanaged type combination (Decimal fields must be paired with Struct).[A]%1 cannot be cast to [B]%2. %3. %4.Type %s originates from '%s' in the context '%s' in a byte arrayType %s originates from '%s' in the context '%s' at location '%s'Collectible context-bound objects are not supported.Cannot load a reference assembly for execution.Attempt by method '%1' to access field '%2' failed.%3Attempt by method '%1' to access method '%2' failed.%3Attempt by method '%1' to access type '%2' failed.%3Loading profiler failed. COR_ENABLE_PROFILING was set properly, but COR_PROFILER was not. COR_PROFILER must be set to the CLSID of the profiler to load.Loading profiler failed due to an internal profiling services initialization failure. Profiler CLSID: '%s'. HRESULT: 0x%x.Loading profiler failed. COR_PROFILER is set to an invalid CLSID: '%s'. HRESULT: 0x%x.Loading profiler failed. COR_PROFILER is set to a CLSID of a COM object that does not implement the interface GUID (IID) requested by the CLR. This often indicates that the profiler does not support this version of the CLR. Profiler CLSID: '%s'. Requested IID: '%s'.Loading profiler failed during CoCreateInstance. Profiler CLSID: '%s'. HRESULT: 0x%x.Loading profiler failed. The profiler COM object was instantiated, but the profiler failed during its initialization callback. Profiler CLSID: '%s'. HRESULT: 0x%x.Process ID (decimal): %d. Message ID: [0x%x].The profiler was loaded successfully. Profiler CLSID: '%s'.Loading profiler failed. COR_ENABLE_PROFILING and COR_PROFILER were set properly, but COR_PROFILER_PATH was not. COR_PROFILER_PATH must be set to the full path of the profiler DLL to load with no more than 260 charaters including the null terminator.There was a failure initializing profiling API attach infrastructure. This process will not allow a profiler to attach. HRESULT: 0x%x.Loading profiler failed. Failed creating interprocess communication infrastructure. HRESULT: 0x%x.Loading profiler failed. Unable to connect to the process that is trying to request the attach. HRESULT: 0x%x.Loading profiler failed. The inter-process communication mechanism was initialized, but an attach request was not received. HRESULT: 0x%x.Loading profiler failed. Failed trying to receive from out of process a request to attach a profiler. HRESULT: 0x%x.Loading profiler failed. The profiler COM object was instantiated, but the profiler does not support attaching to a live process. The profiler must be loaded at application startup by using a launcher program included with the profiler (if any) or by setting the COR_ENABLE_PROFILING and COR_PROFILER environment variables before launching the application to be profiled. Profiler CLSID: '%s'Loading profiler failed. There was an unhandled exception while trying to instantiate the profiler COM object. Please ensure the CLSID is associated with a valid profiler designed to work with this version of the runtime. Profiler CLSID: '%s'.Loading profiler failed. Received an improperly formatted attach request.Loading profiler failed. A profiler is already loaded, so the request to attach another profiler was denied.The CLR received a request to attach a profiler. Profiler CLSID: '%s'.The profiler currently in use has requested to be detached from the process. The CLR has disabled communication with the profiler and will unload the profiler when it is safe to do so.The CLR has fully detached and unloaded the profiler.There was an internal failure in the profiling API detach infrastructure. The profiler will not be able to be detached. Error code: %d.The profiler has requested that the CLR instance not load the profiler into this process. Profiler CLSID: '%s'.Loading profiler failed. The profiler that was configured to load was designed for an older version of the CLR. You can use the COMPlus_ProfAPI_ProfilerCompatibilitySetting environment variable to allow older profilers to be loaded by the current version of the CLR. Please consult the documentation for information on how to use this environment variable, and the risks associated with it. Profiler CLSID: '%s'.A profiler designed for an older version of the CLR was loaded because of the environment variable setting below. Older profilers will continue to work in many cases, but if you encounter problems, please consider upgrading the profiler or changing the setting of the environment variable. Please consult the documentation for information on how to use this environment variable, and the risks associated with it. Environment variable setting: %s=%s. Profiler CLSID: '%s'.A profiler designed for an older version of the CLR was already loaded by an older version of the CLR in the process, and the profiler will therefore not be loaded into this process again. Please consider upgrading your profiler in order to gain better support profiling processes that load multiple instances of the CLR. Profiler CLSID: '%s'.Profilers will not be loaded by the current version of the CLR because of the environment variable setting below. Please consult the documentation for information on how to use this environment variable, and the risks associated with it. Environment variable setting: %s=%s. Profiler CLSID: '%s'.Description: The application encountered a bug. A managed code contract (precondition, postcondition, object invariant, or assert) failed.Contract details: Profiler timed out on waiting for concurrent GC to finish after '%d' milliseconds. Please configure your profiler to increase its attaching time out value or consult the documentation for the COMPlus_ProfAPI_AttachProfilerMinTimeoutInMs environment variable and try again. Profiler CLSID: '%s'.&Abort&Debug&IgnoreUnexpected change made to file '%1'.Marshalling as AnsiBStr is not supportedMarshalling as VBByRefString is not supportedCustom marshalers are not supportedMarshalling between VARIANT and System.Object is not supportedMarshalling arbitrary types is not supportedMarshalling as IDispatch is not supportedIDispatch and IDispatchEx are not supportedAssembly with same name is already loadedDynamically emitted assemblies are unsupported during host-based resolution.Assembly is already bound to an incompatible binding context.Default binding context is already attached to managed load context.Native image cannot be loaded multiple timesA value type containing a by-ref instance field, such as Span, cannot be used as the type for a static field.A value type containing a by-ref instance field, such as Span, cannot be used as the type for a class instance field.Unable to load shared library '%1' or one of its dependencies. In order to help diagnose loading problems, consider setting the LD_DEBUG environment variable: %2Unable to load shared library '%1' or one of its dependencies. In order to help diagnose loading problems, consider setting the DYLD_PRINT_LIBRARIES environment variable: %2Unable to find an entry point named '%2' in shared library '%1'.COM is not supportedWRN: Probed manifest path %s. No such file.WRN: Probed manifest path %s. Ignored. Syntax error or URI encountered.WRN: Probed manifest path %s. Ignored. Unknown error occurred.WRN: Using empty default manifest.LOG: Inspection context locked by manifest. Display name = %s and Codebase = %s.LOG: Using configured manifest from %s.LOG: Using inherited manifest from %s.LOG: Bound to assembly %s.LOG: Assembly is picked up from GAC.LOG: Assembly is picked up from HAS.LOG: Assembly is picked up from byte array.=== Pre-bind state information ===LOG: By-name Bind. Display name = %sWRN: Unsupported partial name Bind. Display name = %sLOG: Where-ref bind. Codebase = %sCalling assembly : %sCalling assembly : unknownLOG: User = %sLOG: User = unknownLOG: Display name not listed in manifest. This is a dynamic bind.LOG: Execution context locked by already bound assembly. Display name = %sLOG: Inspection context locked by already bound assembly. Display name = %sLOG: Execution context locked by manifest. Display name = %s via locked entry.LOG: Execution context locked by manifest. Display name = %s via localizable entry.LOG: Execution context locked by manifest. Display name = %s and Codebase = %s.LOG: Inspection context locked by manifest. Display name = %s via locked entry.LOG: Inspection context locked by manifest. Display name = %s via localizable entry.LOG: Probing GAC for highest service version.LOG: Probing GAC for order-independent assembly version.LOG: Probing GAC for best-matching assembly version.LOG: Display name in codebase = LOG: Mixed-mode assembly bind via native activation. No servicing is possible.LOG: Inspection-only bind.LOG: Retarget: %s retargeted to %sLOG: Erronous manifest entry. Declared as %s but found %sLOG: Attempting path %s*** Assembly Binder Log Entry %s ***Bind result: hr = %sThe operation was successful.The operation failed.--- A detailed log follows.LOG: Assembly is picked up from %s.The format of a DLL or executable being loaded is invalid.Invalid entrypoint information.cvtres.exe not found.Failed to delayload a library.Failed to get dll entrypoint.Multiple copies of mscoree.dll have been loaded into the same process.Type has been unloaded.Attempted to access an unloaded appdomain.Error while unloading appdomain.Assembly is still being loaded.Attempt to create appdomain failed.The module was expected to contain an assembly manifest.Attempt to load an unverifiable executable with fixups (IAT with more than 2 sections or a TLS section.)Attempt to LoadLibrary a managed image in an improper way (only assemblies with EAT area allowed).This assembly is built by a runtime newer than the currently loaded runtime and cannot be loaded.Cannot set security policy under MultiDomain after non-GAC assemblies have been loaded in appdomain.Cannot specify assembly evidence under MultiDomain after non-GAC assemblies with default evidence have been loaded in appdomain.The module cannot be loaded because only single file assemblies are supported.Host detected a deadlock on a blocking operation.Host interrupted a wait.Invalid operation.CLR has been disabled due to unrecoverable error.A wait has timed out.The leave operation has been attempted on a synchronization primitive that is not owned by the current thread.An event has been abandoned.Process exited due to ThreadAbort escalation.Process exited due to AD Unload escalation.Process exited due to Timeout escalation.Process exited due to OutOfMemory escalation.Process exited due to StackOverflow escalation.The check of the module's hash failed.The located assembly's manifest definition does not match the assembly reference.The private assembly was located outside the appbase directory.A module specified in the manifest was not found.Modules which are not in the manifest were streamed in.A strongly-named assembly is required.Strong name signature could not be verified. The assembly may have been tampered with, or it was delay signed but not fully signed with the correct private key.An unexpected error was encountered in the Assembly Cache database.The given assembly name or codebase was invalid.Uninstall of given assembly is not allowed.Application configuration file not allowed in AppX process.Assembly in host store has a different signature than assembly in GAC.The module was expected to not contain an assembly manifest.Reference assemblies should not be loaded for execution. They can only be loaded in the Reflection-only loader context.The native image could not be loaded, because it was generated for use by a different version of the runtime.Contract Windows Runtime assemblies cannot be loaded for execution. Make sure your application only contains non-contract Windows Runtime assemblies.Error occurred during a read.Error occurred during a write.File is read only.Ill-formed name.Data value was truncated.Old version error.A shared memory open failed to open at the originally assigned memory address.Create of shared memory failed. A memory mapping of the same name already exists.No .CLB data in the memory or stream.Database is read only.Importing scope is not compatible with the emitting scope.File is corrupt.Required version of schema not found.Cannot open a incrementally build scope for full update.Null value not allowed in unique index or primary key.Index has been duplicated.The columns data type is not allowed in an index.Index not found.Record not found on lookup.Too many records were returned for criteria.Record is a duplicate.Record is valid but deleted.Record is emitted out of order.Data too large.Column cannot be changed.Too many RID or primary key columns, 1 is max.Primary key column may not allow the null value.Attempted auto-drop of table while open.Object not found in the database.Column not found.Invalid index.A blob or string was too big.A token of the wrong type passed to a metadata function.Typelib import: Invalid type, not converted.Typelib import: Invalid type, not converted - name unknown.Typelib export: TLBX_E_CTX_NESTEDTypelib export: General error. See IError info for more information.Typelib export: SaveAllChanges() failed.Typelib export: Type library is not registered.Typelib export: Type library could not be loaded.Typelib import: Invalid vartype, not converted.Typelib export: Could not load mscoree.tlb.Typelib export: Could not get a required typeinfo from mscoree.tlb.Typelib import: Fault reading a typelib.Typelib import: Multiple [lcid] parameters on a method.Typelib import: Duplicate or ambiguous return types.Typelib import: Duplicate name (due to user-defined name).Typelib export: Cannot convert non-sequential structs.Typelib import: The resolve ref call failed.Typelib export: Encountered AsAny - ignored.Typelib export: Encountered an [lcid] attribute set to an invalid parameter.Typelib export: Encountered an [lcid] attribute on a pure dispatch interface.Typelib export: Non-public field in public struct.Typelib export: Bad names list.TypeLib export: generic type instance in signature.TypeLib export: generic type parameter in signature.Attempted to define an object that already exists.A guid was not provided where one was required.Merge: an import typedef matched ns.name, but not version and guid.Merge: conflict between import and emit.TypeLib export: Detected array of SafeHandles.Merge: Class already in emit scope, but member not found.Merge: Parameter information mismatched.Merge: Inconsistency in meta data import scope.Merge: Class already in emit scope, but interfaceimpl not found.TypeLib export: Detected array of CriticalHandles.Merge: Duplicate classes have inconsistent class layout information.Merge: Field is duplicated but no matching FieldMarshal information.Merge: Method is duplicated but no matching event info.Merge: Method is duplicated but no matching property info.Bad binary signature.Bad input parameters.Merge: duplicated methods have inconsistent ImplFlags.Merge: Inconsistency in meta data.Cannot resolve typeref.No logical space left to create more user strings.Unexpected TokenRemap.Unmark all has been called already.Must call UnmarkAll first before marking.Merge: duplicated types or methods have inconsistent GenericParams.Merge: different event counts in import and emit scopes.Merge: different property counts in import and emit scopes.Merge: An input scope has a TypeRef which does not have a matching TypeDef.TypeLib export: cannot open the module to export.TypeLib export: cannot load a class.TypeLib export: the hModule of a loaded class is 0; cannot export it.TypeLib export: no CLSID or Interface subkey to HKCR.TypeLib export: attempted to export an Assembly imported from a TLB.TypeLib import: attempted to import a TLB exported from an Assembly.TypeLib export: bad Native type in method signature.TypeLib import: non-increasing vtable (duplicate slots).TypeLib export: the COM register method is non static.TypeLib export: the specified COM register method does not have the correct signature.TypeLib export: cannot load CLR type.TypeLib export: unknown element in signature.TypeLib import: reference to an external typelib.TypeLib import: an imported typelib has an invalid namespace name.Typelib export: an error on Layout()Typelib import: Interface not derived from IUnknown.Typelib export: Non COM visible value type in method signature.Typelib export: Types which contain the native type NATIVE_TYPE_LPTSTR are not allowed to be exported to COM.Typelib export: Types with a charset of auto are not allowed to be exported to COM.Typelib export: The enum value is not legal for a typelib.Typelib export: Duplicate IID.Typelib export: detected nested arrays.Typelib import: parameter type could not be converted.Typelib import: parameter type could not be converted - parameter name unknown.TypeLib export: size agnostic element in signature.TypeLib export: exporter failed.Typelib import: [dual] interface not derived from IDispatch.Typelib export: bad signature.Typelib export: non-fixed or non-safearray array in struct.Typelib export: non-interface class in struct.Known custom attribute on invalid target.Known custom attribute had invalid value.Known custom attribute blob has bad format.Known custom attribute blob has repeated named argument.Known custom attribute named argument not recognized.Known attribute named argument does not support variant.Known attribute named argument does not support array.Known attribute parser found unexpected type.Known attribute parser only handles fields, not properties.Known attribute parser found an argument that is invalid for the object it is applied to.The format of the UUID was invalid.The MarshalAs attribute has fields set that are not valid for the specified unmanaged type.The specified unmanaged type is only valid on fields.The parameter index cannot be negative.The multiplier cannot be negative.The constant size cannot be negative.A fixed string requires a size.A custom marshaler requires the custom marshaler type.A DllImport attribute requires a filename.TypeLib import: Detected properties in a source dispinterface.SaveDelta was called without being in EnC mode.Merge: different method counts in import and emit scopes.Merge: different field counts in import and emit scopes.Merge: different parameter counts in import and emit scopes.TypeLib export: Exporting a TypedReference.TypeLib export: bitness of assembly does not match bitness of output type library.InternalsVisibleTo can't have a version, culture, or processor architecture.Rid is out of range.Coded token type is out of range.Coded rid is out of range.String offset is invalid.GUID offset is invalid.Blob offset if invalid.Module has null MVID.TypeRef name is NULL.TypeRef has a duplicate.TypeDef name is NULL.TypeDef has a duplicate based on name+namespace.TypeDef has a duplicate based on GUID.TypeDef that is not an Interface and not System.Object extends nil parent.System.Object extends a non-nil parent.TypeDef extends sealed class.TypeDef is Deleted but not marked with RTSpecialName.TypeDef is marked RTSpecialName, but is not a Deleted record.MethodImpl's Decl is private.Assembly [Ref] name has path and/or extension.File has a system name (con, com, aux, etc.).MethodImpl's body is static.TypeDef is marked Interface but parent is not Nil.TypeDef is marked Interface but GUID is NULL.TMethodImpl's Decl is final.TypeDef is marked ValueType but not marked Sealed.Parameter has extra bits in flags.InterfaceImpl has a duplicate.MemberRef name is NULL.MemberRef has an invalid name, _VtblGap*.MemberRef has an invalid name, _Deleted*.MemberRef parent Nil in a PE file.MemberRef has invalid calling convention.MemberRef has Method parent but calling convention is not VARARG.MemberRef name different from parent MethodDef.MemberRef signature different from parent MethodDef.MemberRef has a duplicate.ClassLayout parent TypeDef is marked AutoLayout.ClassLayout has bad PackingSize.ClassLayout has a duplicate.FieldLayout2 has bad offset.FieldLayout2 has field with nil parent.FieldLayout2 has no ClassLayout record.FieldLayout2 parent TypeDef is not marked with ExplicitLayout.FieldLayout2 has field marked Static.FieldLayout2 has a duplicate.ModuleRef name is NULL.ModuleRef has a duplicate.TypeRef has a bad resolution scope.TypeDef marked nested has no encloser.TypeDef extends a TypeRef which resolves to a TypeDef in the same module.Signature specified is zero-sized.Signature does not have enough data at specified byte.Method signature has invalid calling convention.Method is marked static but has HASTHIS/EXPLICITTHIS set on the calling convention.Method is not marked static but is not HASTHIS or EXPLICITTHIS.Method signature is missing the argument count.Signature missing element type.Signature missing token.Signature has bad token.Signature is missing function pointer.Signature has function pointer missing argument count.Signature is missing rank specification.Signature is missing count of sized dimensions.Signature is missing size of dimension.Signature is missing count of lower bounds.Signature is missing a lower bound.Signature has bad element type.Signature has value array missing size.Field signature has invalid calling convention.Method name is NULL.Method has parent NIL.Method has a duplicate.Field name is NULL.Field has a duplicate.Multiple Assembly records found.Assembly name is NULL.E_T_VALUETYPE or E_T_CLASS.Class layout on an Interface.AssemblyOS platform ID invalid.AssemblyRef name is NULL.TypeDef not nested has encloser.AssemblyRefOS has invalid platform ID.File name is NULL.ExportedType name is NULL.ManifestResource name is NULL.File has a duplicate.File name is fully qualified.ExportedType has a duplicate.ManifestResource has a duplicate.ManifestResource is neither Public nor Private.Enum has no value__ field.Enum's value__ field is static.Enum's value__ field is not SpecialName.Enum's field is not static.Enum's field is not literal.Enum's field signature does not match value__ signature.Enum's value__ field is not first.Field is RTSpecialName but name is not value__.Field value__ in not Enum class.Instance field in interface.Non-public field in interface.Global field or method is neither Public nor PrivateScope.Global field or method is not static.Global field has no RVA..ctor or .cctor has zero RVA.Field is marked marshaled but has no marshaling record.Field has marshaling record but is not marked marshaled.Field has const value record but is not marked HasDefault.Field or method is marked HasSecurity but has no security record.Field or method has security record but is not marked HasSecurity.Field or method is PInvoke but is not marked Static.Field or method is marked PInvoke but has no ImplMap.Field or method has ImplMap but is not marked PInvoke.Field or method has invalid ImplMap.ImplMap has invalid ModuleRef.ImplMap has invalid MemberForwarded.ImplMap has invalid ImportName.ImplMap has invalid call conv.Field or method has invalid access flag.Field is InitOnly and Literal.Field is Literal but not Static.Field or method is RTSpec.Name but not Spec.Name.Method is abstract, parent is not.Method not static or abstract in interface.Method not public in interface..ctor in interface.global .ctor or .cctor.static .ctor..ctor or .cctor not marked SpecialName or RTSpecialName.virtual .ctor or .cctor.abstract .ctor or .cctor.instance .cctor.RVA set to zero, but method not abstract or pinvoke or runtime, or reverse.Method is final and not virtual.Method is static and final or virtual.Method is abstract and final.Method is abstract and implemented.Method is abstract and pinvoke.Method is abstract and not virtual.Method is not abstract and not implemented.Method is not abstract and not (non-zero RVA or PInvoke or runtime).Method is PrivateScope and has RVA set to zero.Global method is abstract or virtual.Signature uses long form.Method has multiple semantics (warning).Method has invalid semantics (not event or property.)Method has semantics association that does not exist.MethodImpl's Decl is not virtual.Global field or method (warning, CLS).Method has multiple semantic flags set.Method has no semantic flags set.Field in Interface (warning, CLS).Unrecognized Hash Alg ID (warning).Unrecognized Processor ID in Assembly(warning).Unrecognized Processor ID in AssemblyRef(warning).Constant: parent token out of range.Invalid flags in Assembly.There is TypeDef with same name as TypeRef (warning).In InterfaceImpl, the implementing token is not TypeDef.In InterfaceImpl, the implemented token is not TypeDef or TypeRef.TypeDef has security record but it is not marked HasSecurity.TypeDef marked HasSecurity but has no security record..cctor has arguments.ExportedType has invalid Implementation.MethodImpl has body from other class..cctor has invalid calling convention.MethodImpl has invalid Class token.MethodImpl declared in Interface.MethodImpl has invalid MethodDeclaration token.MethodImpl has invalid MethodBody token.MethodImpl has duplicate.Bad field parent.Parameter out of sequence (warning).Parameter's sequence number exceeds number of arguments.Parameter marked HasMarshal, has no marshaling info.Parameter has marshaling info, not marked HasMarshal.Parameter marked HasDefault, has no const value.Parameter has const value, not marked HasDefault.Property has invalid scope.Property has a duplicate.Property has bad calling convention.Property marked HasDefault, has no const value.Property has const value, not marked HasDefault.Property has method that is neither a Setter nor a Getter.Property has method with invalid token.Property has method from another class.Const has non-null blob when it should not.Const has null value blob.Event has invalid scope.Event has a duplicate.Event has invalid EventType.Event's EventType is not a class.Event has method not (AddOn,RemoveOn,Fire,Other).Event has method with invalid token.Event has method from another class.Event has no AddOn method.Event has no RemoveOn method.ExportedType has same name as TypeDef.MRes refers to non-PE file with non-zero offset.Declarative security has invalid owner token.Declarative security has invalid action flags.Declarative security has no permission blob.Manifest resource has invalid Implementation.MemberRef has VARARG calling conv. (CLS warning)..ctor or .cctor returns something other than void.Fire method returns something other than void.Invalid locale.Constant has parent of invalid type.E_T_SENTINEL in MethodDef signature.E_T_SENTINEL <=> VARARG.Multiple E_T_SENTINELs.E_T_SENTINEL not followed by type.Signature missing argument.Synchronized method in value class.TypeDef name too long.Duplicate Assembly Processor.Duplicate Assembly OS (ID+ver.major+ver.minor).Manifest Resource has bad flags.ExportedType has nil TypeDefId.File has bad flags.File has no hash blob.Module has fully-qualified name.TypeDef is tdRTSpecialName but not tdSpecialName.TypeDef extends interface..ctor or .cctor is PInvokeImpl.System.Enum is not a class.System.Enum extends not System.ValueType.MethodImpl's Decl and Body signatures mismatch.TypeDef extends System.Enum but has methods.TypeDef extends System.Enum but implements an interface.TypeDef extends System.Enum but has a property.TypeDef extends System.Enum but has an event.TypeDef has MethodList > Nmethods+1.TypeDef has FieldList > Nfields+1.Constant has wrong type.Enum has no instance fields.Validator has been interrupted by the VEHandler.Validator failed to initialize correctly.Unrecoverable API error.Process was terminated.Process not synchronized.A class is not loaded.An IL variable is not available at the current native IP.A reference value was found to be bad during dereferencing.A field in a class is not available, because the runtime optimized it away.'Native-frame-only' operation on non-native frame.Cannot Continue on non-continuable exception.The code is currently unavailable.Attempt to get a ICorDebugFunction for a function that is not IL.SetIP is not possible because SetIP would move EIP from outside of an exception handling finally clause to a point inside of one.SetIP is not possible because it would move EIP from within an exception handling finally clause to a point outside of one.SetIP is not possible, because SetIP would move EIP from outside of an exception handling catch clause to a point inside of one.SetIP cannot be done on any frame except the leaf frame.SetIP is not allowed.Func eval cannot work. Bad starting point.This object value is no longer valid.CordbEval::GetResult called before func eval has finished.The in-process version of the debugging API does not support this function.A static variable is not available because it has not been initialized yet.Cannot copy a VC with object refs in it.SetIP cannot leave or enter a filter.JIT settings for ZAP modules cannot be changed.SetIP is not possible because it would move EIP from within a finally clause to a point outside of one on WIN64 platforms.SetIP is not possible because it would move EIP from within a catch clause to a point outside of one on WIN64 platforms.The remote device closed the connection.The connection was closed due to a keep-alive failure.Generic error that the device connection has been broken with no chance for recovery.Cannot use JMC on this code (likely wrong JIT settings).The stack walk has reached the end of the stack. There are no more frames to walk.Internal frame markers have no associated context.The current frame is not a child frame.The provided CONTEXT does not match the specified thread.The stackwalker is now past the end of stack. No information is available.Func eval cannot update a variable stored in a register on a non-leaf frame. The most likely cause is that such a variable is passed as a ref/out argument.The state of the thread is invalid.This process has already been attached.Returned from a call to Continue that was not matched with a stopping event.Cannot perfrom SetValue on non-leaf frames.When doing Edit and Continue, some JITs do not allow increasing the maximum level to which exception handling can be nested.Tried to do Edit and Continue on a module that was not started in Edit and Continue mode.SetIP cannot be done on any exception.The 'variable' does not exist because it is a literal optimized away by the compiler.Process has been detached.Not allowed to change the signature of an existing method.Adding a field to a value or layout class is prohibited.Cannot change field after adding.Only support addition of private members.GetStaticFieldValue called on a non-static field.Returned if someone tries to call GetStaticFieldValue on a non-instance field.If a zap file was created without the Edit and Continue flag set, then we cannot do Edit and Continue on it, no matter what.Lacking information about method.The JIT is unable to update the method.An internal structure about the class is missing.Internal Runtime Error while doing Edit-and-Continue.The field was added via Edit and Continue after the class was loaded.Module not loaded.Not allowed to change base class.Cannot set a breakpoint here.Debugging is not possible due to an incompatibility within the CLR implementation.A kernel debugger is enabled on the system. User-mode debugging will trap to the kernel debugger.A kernel debugger is present on the system. User-mode debugging will trap to the kernel debugger.The debugger's internal helper thread is dead.The debugger's protocol is incompatible with the debuggee.The debugger can only handle a finite number of debuggees.Interop debugging is not supported.Cannot call RemapFunction until have received RemapBreakpoint.Object is in a zombie state.Function not yet compiled.The ID is not fully loaded/defined yet.The Module is not configured for updateable methods.The Method could not be updated for re-JIT.The Method has no associated IL.The thread has never run managed code before.The function may only be called during profiler initialization.In-process debugging must be enabled during initialization.Cannot get a JIT map becuase they are not enabled.BeginInprocDebugging already called.In-process debugging not allowed at this point.Requested information is not yet available.The given type is a generic and cannot be used with this method.The given function is a generic and cannot be used with this method.Failed to convert XML to ASN.Loading this assembly would produce a different grant set from other instances.Unverifiable code failed policy check.Assembly already loaded without additional security evidence.Failure decoding permission set.Failure encoding permission set.Unrecognized encoding format.Invalid security custom attribute.PolicyException thrown.Failed to grant minimum permission requests.Failed to grant permission to execute.XML Syntax error.Assembly is not strong named.Invalid assembly file format.Invalid assembly public key.Signature size mismatch.Public key of assembly did not match signing public key.Invalid signature public key specified in AssemblySignatureKeyAttribute.Invalid countersignature specified in AssemblySignatureKeyAttribute.Failure during Cryptographic operation.Unexpected Cryptographic operation.Generic problem with a custom attribute.Missing a required constructor.Unable to create a permission for this attribute.Bad custom attribute serialized blob.Bad custom attribute serialized blob version.Invalid security action code.CA reference to CA definition in same assembly.Use of non-CAS permission with invalid action.Failed to load assembly containing CA (or required CA type).Failed to load CA type (or required CA type).CA type is abstract.Unsupported base type for enum field or property.Could not find a CA field.Could not find a CA property.Unexpected exception.General ExceptionSystem.ExceptionAn argument was out of its legal range.Attempted to store an object of the wrong type in an array.Attempted to marshal an object across a context boundary.Operation timed out.Internal CLR error.Access to this field is denied.Array subscript out of range.An operation is not legal in the current state.An error relating to security occurred.An error relating to remoting occurred.An error relating to serialization occurred.A verification failure has occurred.An error relating to ServicedComponent occurred.Access to this method is denied.Field does not exist.Member does not exist.Method does not exist.Attempt to combine delegates that are not multicast.Operation is not supported.Arithmetic, casting or conversion operation overflowed or underflowed.An array has the wrong number of dimensions for a particular operation.This operation must be called from a synchronized block.Access to this member is denied.Thread is in an invalid state for this operation.Thread is stopping.Could not find or load a type.Could not find the specified DllImport entrypoint.Could not find the specified DllImport Dll.An invalid __ComObject has been used.Not a Number.An object appears more than once in the wait objects array.Reached maximum count for semaphore.No semaphore of the given name exists.The wait completed due to an abandoned mutex.Thread has aborted.OLE Variant has an invalid type.An expected resource in the assembly manifest was missing.A mismatch has occurred between the runtime type of the array and the sub type recorded in the metadata.Uncaught exception during type initialization.Invalid marshaling directives.An expected satellite assembly containing the ultimate fallback resources for a given culture was not found or could not be loaded.The format of one argument does not meet the contract of the method.A mismatch has occurred between the runtime rank of the array and the rank recorded in the metadata.Operation is not supported on this platform.Invalid IL or CLR metadata.The operation was cancelled.Devices not supported.A datatype misalignment was detected in a load or store instruction.A managed code contract (ie, precondition, postcondition, invariant, or assert) failed.Access to this type is denied.Fail to access a CCW because the corresponding managed object is already collected.A method in this assembly is greater than the maximum allowed method size.The given key was not present in the dictionary.Insufficient stack to continue executing the program safely. This can happen from having too many functions on the call stack or function on the stack using too much stack space.Application exceptionThe given filter criteria does not match the filter content.Could not find or load a specific class that was requested through Reflection.Attempt to invoke non-static method with a null Object.Uncaught exception thrown by method called through Reflection.Custom attribute has invalid format.Error during managed I/O.Could not find or load a specific file.The object has already been disposed.Runtime operation halted by call to System.Environment.FailFast().The host has forbidden this operation.Attempted to call into managed code when executing inside a low level extensibility point.Failed to load the runtime.Failed to find a required export in the runtime.Install root is not defined.Expected component of the runtime is not available.A runtime has already been bound for legacy activation policy use.The operation is invalid because the process may be shutting down.Unknown opcode.Unknown calling convention.Unknown ELEMENT_TYPE.fall through end of the method without returningtry start >= try endtry end > code sizehandler start >= handler endhandler end > code sizefilter >= code sizefallthru the end of an exception blockfallthru into an exception handlerfallthru into an exception filterEndfinally from outside a finally handlerEndfilter from outside an exception filter blockldftn and ldvirtftn not allowed on .ctor.Expected single dimension array.Missing call, callvirt or calli.Missing ldsfld, stsfld, ldind, stind, ldfld, stfld, ldobj, stobj, initblk or cpblk.Missing ldind, stind, ldfld, stfld, ldobj, stobj, initblk or cpblk.branch or leave to the beginning of a catch/filter handlerCall to .ctor only allowed to initialize this pointer from within a .ctor. Try newobj.Missing ldelema or call following readonly. prefix.Missing callvirt following constrained. prefix.Cannot LDFTN a non-final virtual method.Ldtoken instruction required before call to System.Runtime.CompilerServices.InitializeArray.Interface in InterfaceImpl is not marked tdInterface.Field marked fdHasFieldRVA but has no RVA record.Field marked fdHasFieldRVA has RVA set to zero.Method has both non-zero RVA and ImplMap.TypeDef has extraneous bits in flags.System.ValueType does not extend System.Object.Class extends TypeSpec (warning).Value Class has zero size.Interface is sealed.Bad 'nested' token in NestedClass.Bad 'enclosing' token in NestedClass.Duplicate NestedClass record.Duplicate NestedClass with different encloser.RVA set to zero in FieldRVA record.Invalid field token in FieldRVA record.Duplicate RVA in FieldRVA record.Duplicate field in FieldRVA record.Bad token as entry point in CLR header.Entry point in CLR header is a token of instance method.Enum has non-integral underlying type.Method has bogus RVA.Class implementing an interface does not implement one of methods.CA has invalid owner.CA has invalid type.CA type is not .ctor.CA type has bad signature.CA type has no signature.CA blob has bad prolog (not 0x01 0x00).Method has invalid LocalSig token.Entry point has more than one argument.Entry point has bad return type.Entry point has bad argument.Illegal 'void' in signature.Multiple implementation of method.GenericParam name is NULL.GenericParam has duplicate by owner and name.GenericParam has duplicate by owner and number.GenericParam is non sequential by owner.GenericParam is non sequential by number.GenericParam has variance but its owner is not an interface or delegate.GenericParam is a method type parameter and must be non-variant.GenericParam has illegal value for variance flags.GenericParam has incompatible special constraints reference type and valuetype.GenericParamConstraint has duplicate by owner and constraint.GenericParamConstraint is non-contiguous with preceeding constraints for same owner.MethodSpec has duplicate based on method and instantiation.MethodSpec signature has invalid calling convention.MethodSpec signature is missing arity specification.MethodSpec signature is missing type argument.MethodSpec arity of generic method and instantiation do not match.Signature missing arity of instantiated generic type.Signature has generic type of arity instantiated at different arity.Method signature is generic but is missing its arity.Method signature is generic but its arity is zero.Signature has generic type instantiated at arity 0.MethodSpec signature has arity 0.MethodDef signature has arity n but owns m GenericParams.MethodImpl overrides non-generic method with generic method.MethodImpl overrides generic method of arity n with generic method of arity m.TypeDef extends a TypeSpec that is not an instantiated type.Signature has type instantiated at ByRef at offset i.Signature has token following ELEMENT_TYPE_CLASS (_VALUETYPE) that is not a TypeDef or TypeRef.Warning: Class does not implement interface method in this module.Thread is not scheduled. Thus we may not have OSThreadId, handle, or context.Handle has been disposed.Cannot intercept this exception.When intercepting an exception, cannot intercept above the current frame.The intercept frame for this exception has already been set.There is no native patch at the given address.This API is only allowed when interop debugging.There is already a native patch at the address.A wait timed out, likely an indication of deadlock.Cannot use the API on this thread.Method was not JIT'd in EnC mode.Frame cannot be updated due to change in max nesting of handlers.Method is in a callable handler/filter. Cannot increase stack.Frame cannot be updated due to localloc.Attempt to perform unsupported edit.Attempt to func eval abort on a suspended thread.The LS is not in a good spot to perform the requested operation.We failed to resolve assembly given an AssemblyRef token. Assembly may be not loaded yet or not a valid token.Must be in context of LoadModule callback to perform requested operation.Requested operation cannot be performed during an attach operation.NGEN must be supported to perform the requested operation.Trying to shutdown out of order.Debugging fiber mode managed process is not supported.Must be in context of CreateProcess callback to perform requested operation.All outstanding func-evals have not completed, detaching is not allowed at this time.All outstanding steppers have not been closed, detaching is not allowed at this time.Cannot have an ICorDebugStepper do a native step-out.All outstanding breakpoints have not been closed, detaching is not allowed at this time.The operation is illegal because of a stack overflow.The operation failed because it is a GC unsafe point.The operation failed because the thread is in the prolog.The operation failed because the thread is in native code.The operation failed because the thread is in optimized code.The information requested is not supported by minidumps.A supplied object or type belongs to the wrong AppDomain.The thread's context is not available.The operation failed because debuggee and debugger are on incompatible platforms.The operation failed because the debugging has been disabledDetach is illegal after an Edit and Continue on a module.Cannot intercept the current exception at the specified frame.The debugger helper thread cannot obtain the locks it needs to perform this operation.The operation failed because the debugger could not get the metadata.The debuggee is in a corrupt state.Detach failed because there are outstanding resources in the target.The debuggee is read-only.The version of clr.dll in the target does not match the one mscordacwks.dll was built for.Symbols are not supplied for modules loaded from disk.The application did not supply symbols when it loaded or created this module, or they are not yet available.A debug component is not installed.Connection authentication failed due to mismatched certificates.Connection failed due to a miscellaneous network error.Connection failed due to no endpoint at remote machine (no proxy configured?).Connection failed due to inability to locate remote machine.Local debugger configuration was missing or invalid.Connection failed due to protocol version mismatch between local and remote components.The ICLRDebuggingLibraryProvider callback returned an error or did not provide a valid handle.The module at the base address indicated was not recognized as a CLRThe provided data target does not implement the required interfaces for this version of the runtimeThis debugging model is unsupported by the specified runtimeThe debugger is not designed to support the version of the CLR the debuggee is using.The version struct has an unrecognized value for wStructVersionA call into a ReadVirtual implementation returned failureThe Debugging API doesn't support dereferencing function pointers.The address provided does not point to a valid managed object.The GC heap structures are not in a valid state for traversal.The specified IL offset or opcode is not supported for this operation.The specified action is unsupported by this version of the runtime.The debuggee memory space does not have the expected debugging export table.Failure when calling a data target method.Couldn't find metadata for the given executable code.Given executable code is not managed.Couldn't find a native image.The type doesn't exist in the given module.Couldn't find metadata for the given vtable.Couldn't find any generics information.File is empty.File has no NT headers.File is PE32+.File has no COR header.Flag IL_ONLY not set.Bad import DLLs.EXE file has no mgd entry point.Bad base relocations.Bad managed entry point.OptHeader.SizeOfCode is set to zero.File has invalid COR header.File is PE32The operation was interrupted by the CLR Optimization Service controller.Failed to get dependencies for assembly.Failed to delete native image.Module contains too many interfaces to successfully compile all methods.Requested runtime does not support side-by-side NGen.Worker exited unexpectedly during startupFailed to synchronize with worker during startupNGen cannot proceed because Mscorlib.dll does not have a native imageThe image file is not compatible with the version of Ngen you're running. Use 32bit Ngen for 32bit assemblies, and 64bit Ngen for 64bit assemblies.There was an error parsing the NGen assembly exclusion Xml file.A hardbound dependent native image is missing.NGen is not running in expected package.The image being compiled is not a .NET assemblyThe bound assembly has a version that is lower than that of the request.The assembly version has a public key token that does not match that of the request.The requested image was not found or is unavailable.The provided identity format is not recognized.A binding for the specified assembly name was not found.A binding for the specified type name was not found.Could not use native image because Mscorlib.dll is missing a native imageNative image was generated in a different trust level than present at runtimeNative image identity mismatch with respect to its dependenciesFailfast due to an OOM during a GCFile or assembly name '%1' was not found.The system cannot open file '%1'. There may be too many open files.Access is denied: '%1'.The format of the file '%1' is invalid.Cannot access file '%1' because it is being used by another process.Cannot access file '%1' because another process has locked a portion of the file.Cannot open file '%1'.The path is too long after being fully qualified. Make sure the full path is less than 260 characters and the directory name is less than 248 characters.There is not enough space on the disk. Unable to load '%1'.The filename, directory name, or volume label syntax is incorrect: '%1'.A procedure imported by '%1' could not be loaded.Cannot create/shadow copy '%1' when that file already exists.The volume does not contain a recognized file system.'%1' is not a valid file.The dll initialization routine failed for file '%1'.The specified user does not have a valid profile. Unable to load '%1'.The file or directory for '%1' is corrupt and unreadable.The disk structure is corrupt and unreadable. Unable to load '%1'.The actual object was not found for '%1'.Connection was established, but data cannot be retrieved for '%1'.WinInet download failed for URL '%1'.Unknown URL protocol: '%1'.Security problem encountered when connecting to URL for '%1'.Could not load type '%1' from assembly '%2'.FF0:s *Dw= F׾ɦm?(=ɦmY!Ax6UT8GN%Q0+Suuɴ +R&C9XG؛M0d&A)؈sOq- '5S)6dC݂/#PrOyGDbH Xn:{0OyV8OyLOy\1.Oy6pyJ'UfBc E4-G 4`QA'T:cZOCG|GEG|GEn:-]NFBfT\FH|53wO1zuǒUWCsqɴ sqɴ q ɰ%rO.esqɴ L?AN?YPB{>F}uLgI}DO6 "f O O[!S8D{v GbKNB|/$ GOy1Oy~6VɷEy-@K]c\hp_ۺXCHdyHŠNAq ɰ%(?ZkOFE(I^PGo%pZɷČ-#.J# Ş)}E]qs~T⨅HO*zG L|/ yL*xxcƋM Nd./lwbGz^k?*q",H~׷,-fdO C F0q ɰ"q ɰ#q ɰ!g# tGR*bF-$}$Mm!AND<yp`H Iɑ~YeѲO~#a-z3*KI% a;qNb=ȭ9&ךKўBWuฌ @(n~#1HH2M>~* vJl3EAoOf#v-3BPܤ[Undefined resource string ID:0x%X];2T2t$$̔%|%%|&4'4(t(L)*2+3,43d,T3T-|3-3-3D345,45T494?4?4@5@|4@5dDD5tD\5E|5I5DJ5J5K5K6K46KL6Kl6K6K6$M6M6N6O7P<7P\7Q|7DQ7Q7Q7R8TR48RT8Sl8tS8S8$T8T8T8$U9tU9U49VL9tVd9V|94W9W9W9TX9X9Y :tY$:Y<:4ZT:Zl:d[:$\:\:]:t^;$_<;_\;`|;`;4a;a;a;a<Dc,<cL<ct<$f<tf<f<g=g=g4=gT=hl=h=h=$i=4i=i=i>j<>j\>k|>Tk>k>l>l?dm$?mD?dol?q?q?q?tt?tu@z@T{@{@{ A{$A{\W?W$?WT?W?W@W@X@,X@DX@\XA|XAXBXBXBX$CYC4ACdD<$E\$F|4FDFTFĜFFDGG<$IdJDKK̝M$MtM$ND$N\DNtdNNNĞPPDPP4PLTQtQSğSDT T4VX\\eԠ$jp$$p<4pTdptppqġ$qܡrrDr<s\$s|ssTtܢtt t$uDuduvẉxDxTx,xL$yt4yDyTyyܤyyz4zL$zd4z|D{d{{ܥd|||<|T}|D̦D 44Ĉ\ԉ̧ĊԊ,TTܨԕ<$T|d̩ĥ4D4\tԪDd4tLd|DܫıT4TԲt$ĵܬDT$tDdTDܭ$LtTT,TD|̯$D<d\$԰4LdṯDL$t$IJ4ܲ4LtTdt̳T ,D4ddĴT 4T\t4<D\|̶4$<dT d t ̷ 44 |T \ Ը   < dܹ4tT|4ԺD,DTt !Ի"#%4t%Tt&tT'($)Լ)*t,<,\T-|4.4/Ľ0113<3T3l44$4d4Ծt4446,6T6l7748Կ88T949T9l9::::: t;,;L;d;|;;DAAAB4BTC|DETEEE4F<DFTFtFG4JJJJJ4JLJdJ|KKdKKK L4$MTDMltMMMNTNNN$ODTQlQ4RRSSS$TDT\dUVTWWXY<Z\Z[T\] t^4_\d_|``tac$dLddd|Detftgh i4j\jtTkdktkll m4mLndn|$n4nDntnnno4p\qrrTstsss,sDsds|ttDttt Du,vL$vdx|Tt$LądDċ $,$T4lĒē$DĔltD4t,DlDԝġDd4t\$<dDԯ4TTD$$<4TDlT4TdT<\Td|T D4T4tD4\t$$D4\DtT$4DTd 44D\t$4Ldd ,Llt <$dTt$D$Ddd4 D$DdDt$!,"l""$#t##'$4(l$)4)D)d)* ,4-T/|$11143d3t343T4t45679,:T;t;<>? 4?,?L?ld@@dAAB TC,tCDDLDlDDFF$F G,GL$ItIIIJ4J DJ$tJDJdKdKKdLLM$MDMdN|N8PD>d>?@$t@D@dTAAABDBC$C<$CTE|FtFFG$H<DJdKX^^^ _$_<_T4`tTazRx $ FJ w?;*3$"$D=AC PlLAC BKAC B$AC JFAC C6AC BzPLRx! $$^AC P$L8M3AC L$`MAC G$AC PP A$HAC P 4AC C$4 AC G\ $d qAC NAC B$AC P$AC J$p<TlcAC FH @*AC BPH@8AC I`AC 4AC IT8AC ItAC I@=AC C`=AC C$;3AC C$;#AC C$@AC C$<@AC CtAAC SF V hTDC ,ODO\MtPMORRP\VR(\4p\L\dR|HR\V$ AC K AC I h!AC I$,"AC KT"AC ItP#AC E#AC I$AC %RH%A %A %<AC C< %AC B$L%\ AC I 'LAC B$@'SAC F$x'/AC N$)O'AC F )AC < )xAC \ *jt `* X*2AC B x* + +8AC B 8+1AC B X+4 P+vAC CT +%$\ +AC F p,AC B p,0AC B ,FAC B ,CAC B ,WAC C$$ -vSAC F\ x-AC G| 8.oAC $ .'AC K$ /KAC K 1"AC  1AC $ 1cAC NT p4AC Cd P5^AC PB.N.x.Z.b.n.K.`.P'.O.g.d.O.a.e.S.O.R.Y.Y.p.R.m.T.Z.f.Y.Z.\._.Y.Z.E. :qAC F$:0AC D:8AC d: |: :0AC B:,AC B:-AC B:XAC $;V{AC C$,H;e{AC Fd;#JC ;;; ;$;eAC F ;$;<;T;l;AC ;$;ecAC F<<<9AC C(<6AC B$,H<{AC C$T<AC F$|=AC G$=e AC F>> >BAC C,8>GAC CLh>@AC Bl>>>BAC C>4AC >AC F$x?}AC G$$?AC MLAAC lA$tAcAC MDAC GE$ EAC M FAC G$,GAC MTIAC FtpIAC CPJaAC BJAC CpKAC FAC KPAC F4 LAC CTLAC Ft`AC `MAC C0NAC FNAC COAC F PAC C4PAC CTQAC FtRAC FRQAC B$RSAC JTAC F(VAC FVAC C<Wh$TW4AC G$lY0AC N[5AC F0\@AC GP]AC C$]HCAC P,_AC F$<`7AC P$tcAC J$Hd#AC PgAC FgAC G$phAC P,HjAC G$<jAC PtpmAC G$nAC MAC B$oAC Mq$ qOGAC L$DrAC G$\xt#AC P$`v1'AC J$xw+AC PPyAC CylAC C$ z\AC BD`zlAC CdzAC B {AC B{AC C|tgC p|AC $}[AC M,8AC $<KAC MtAC $KAC MAC 8AC HAC  AC H$,hAC P$d@AC G]AC GXAC GAC E  4Ld|DAC DAC AC AC $/AC M$,WAC J$TrAC JؖAC F$hAC M<AC BОAC $ AC G$,(AC Gd P'$| hMAC M !  !$ AC N$ pAC PAC M3`+ 3X+ 3P+AC G3, 3,AC 4, 44, L4+ d4+ |4+AC C4h, 4p,&$4,8AC M4.$ 5H/AC K45 1L51AAC Bl5H1 5@1eAA51AC 5P2gBA5353 63 ,63AC EL6(4d6 4EAC 6P47AC C$5p4AC P6(9cYC 6x9T79$UC $79<79,AC B\79AC B$l69[AC P$7PbAC K7(;6AC C7H;CAC C 8x;DAC C$,8;AC M$T8P= AC M$|8FAC M8IAC C80JAC F$8K@AC J 9Lk$9pLe<9LAC B\9hMot9Me9NAC B9N>9O79(OAC B9OR:O,:hPKD:Pw\:Q t:Q:Q :Q:Q:Q$:Q@AC M; TYAC 4;`TL;XT|AC Cl;T;T$:T;wAC K$:V;AC K;(YAC $:(Y*AC P$4<0\YAC M$\<^AC K<0`$<8`AC M<a:AC <aDAC $=bAC M$<cAC IT=`dAC Gt= e =e =eT=Xf=i8=(i7>PiN>i4>iL>iY$d>iAC M$>lRAC M$>qVAC M$>vAC J$=v#AC L$>8~9AC GT?z$l?zAC M$?zAC M$?8{AC M$?{AC M @X|1AC ,@x| $D@p|AC Ml@8~@0~i@~AC I@hl@J@AC B$ AAC J4A`nAC GTAPC tAPC AAAAA=AC BBЇ$AC B4BLB؇MAC lBAC BBBB6AC B6AC C0AC B4C0rLCAC HlCH&AC CCXAC CAC HCAC $C( AC P$D< AC PAC PQ.J.O.u.U.M.`.U.l.}.m.D.s.b._.T.S.X.K.P.m.g.E.@.J.E. t.O.e.J.E. v.F.L.q.A.].^.P.Z.e.E.H.`.U.E.H.H.YPDAC PN.J.R..v.v.z._.w.E.r.j.f.Z.X.c.N.`.b.`.O.U.I.l.E.`.U.h.].^.E.E.H.^.U.E.H.H.$t[H AC M[K[AC F[LAC C$[LAC M\PNmAC C$$\N AC PL\xd\R)|\RAC G\(S9\PSj\SAC E\T$]TAC P$,]xXcAC PT]ZAC Lt]P\WAC B]\AC J$\@]wAC P]aAC F$\xb;˭AC P$$^gBAC G$L^hAC Jld]`j AC Pv.f.Q.Z.O.G.u.g.l.~.J.c.L.Y.L.Z.Z.Z.e.G.[.E.H.$^l~AC G$ _Hm~AC G4_mAC F$T_0nQAC M$|_hoAC J$_`prAC G_q&_qyAC F`0sbAC B$_s۬AC P <_| AC Pd.N.N.].X.U.`.d.d..g.^..|..d.v.q.i..m.i.M.t.q.{.C.^.].Y.~.t.w.A.J.x.n.B.C.V.l.X.r.O.].`.O.].Y.O.].`.O.Z.S.Q.O.].Y.O.].Y.O.G.H.H.`.X.U.E.H.H.H.\azAC B$|ah~AC J$aAC Mah\AC CaAC C b"$b AC CcXcP AC d@AC B4d@Ld8dd0|d(;XC dH d@LMC dpEKC cH_AC BdИMWAC B4efAC TePleXAC GeZAC e8fAC e$AC eAC  f3AC ,f$AC LfȚdfК$AC f$AC ff!AC CfeAC Px.z.Q.n.d.s.T.i.c.\.T.M.H.L.R.U.G.N.J.T.M.H.\.i.S.U.E.[.E.H.$|gHAC Kg:AC g0:AC gP$gHfAC G$hAC BDhAC F$dh-AC Jd|g7kAC Pm.z.Q.n.d.s.T.e.c.W.L.G.L.S.c.i.E.[.E.H.|gpkAC Pt.z.Q.o.d.s.T.i.c.T.M.H.L.W.T.M.H.N.G.L.S.c.i.E.[.E.H.tiAC Fi AC CiAC Fiij jSAC AC F$,lhAC C$Tl0AC F$|lAC M$mAC M$mXAC M$lxץAC M$,nTAC M$Tn AC M|nnn&^C n\~C n($o@ o8$4o@AC J\oto%AC BoAC FoAC ogAC o`AC p0Z|C 4pp"Lp dp|pAC BpX%AC BphAC phAC $phAC G$$q@AC GLq)AC lq(q .AC C$p0AC GqqqrIAC 4rAC Trlr/AC Crrrr AC rAC sAC 4sAC ITs`KAC Cts AC Bs$sAC M$s AC P$sAC M$t AAC BDtPAAC B$dtAC M$tAC M$t`AC MtGAC B$t(AC G$u,AC Du $\u@AC M$uAC P$uHAC Ju|$uAC Mv^AC B4vLvAC F$lvhZAC Jv:$vAC J$vdAC M$vAC M$$wRAC M$LwjAC Mtw$wXAC M$w@AC Jww xkAC F,x8&$DxPAC JlxHAC x(x xxjAC Fx`<AC BycAC B4yLyAAC Cly<AC Cy4AC Cy82AC yX#AC yhAC I$ zhAC M4zwAC F$Tz@ AC K|z( AC z( AC $z( AC M$z AC M$ {AC M4{0AC I$T{AC M$|{AC G${,AC P${AC G{0uAC $|AC P<|hzAC F$\|AC J$|AC M$|h|AC M$|iAC J$|!AC J$$}!(AC J$L}"=AC Mt}$FC }$FC $}$#AC M$}%AC M$~p'AC G,~' $D~'AC Ml~h)KC ~h)~p)~h) AC ~X)AC B$~X)m AC P$$6AC JT<~8>kAC Pb.Z.o.c.Y.V.`.Q.[.h.G.].E.H.$~9AC P$~:AC P$`;AC GX< 4P<_AC CT<AC Jt`=X=$P=QAC K̀>PAC B>>AC G$?iAC D?lAC d@@^AC E@ x@nAC E@wAC G܁(APAC FXA]AC CA`AC C$<AAC G$d@BAC G$BnAC G$B[AC M܂(D D?AC B$@EnAC G<ETEoYC tE#AC FF AC JGmAC L$ԃ0IJAC N$XKAC N$0M0AC B$D@MaAC N$lNsAC J$NrAC P8QAC C܄QQ Q $$Q<AC GLQ $dQAC G$|hRCAC CR.CAC ԅRAC BRR?AC B,RDR\StSXAC B$SAC G$hTAC J$`VAC M$ HYAC M$4 [AC M\] t] ]AC I$^AAC Mԇ@_܆8_`;AC Bx_e3AC B,_DjM$\_AC G$`AC MbAC ̈hcAC cAC J dAC L,e AC JLf AC LlgAC BhfAC iAC ̉iAC j#AC  kAC ,HlAC LlAC I$lxmAC M0oyAC oRAC BԊoAC I$pAC Mhq^AC B<rAC B\s tsAC Cuxuċu܋xupu hu1AC ,u Du $\xuAC N$wAC Gw $ČwAC Gx,AC B xZAC C,XxNAC CLxiAC lxWAC Cy1AC B8yč0y ܍(yAC Cyy,yDy8cC dy{AC C@z AC B@z8zԎ0z(z$ zkAC P$,hsAC GTlAC Cx1AC B$?AC J$ĎPCAC C@AC 8EAC E,hAC E\؂ dЂ3AC B AC F̐Xԏ`AC $`AC P,XTD\txԑph `CAC B$>AC DAC $dAC GHAC BȇĒЇ"ܒ!0 6$@6<h3AC C\3AC C|2AC B$Ȉ9AC MēvAC B@_AC BAC C$AC CD(\3AC B|ȌAC CX$PAC M$ܔ؍`AC M$AC K$,xAC KTAC GtAC IpAC G@AAC Bԕp]$XAC M$AC M$<hAC M$dДAC K$8AC K[AC F$Ԗ%AC KAAC B\m4AC I$DpM߁AC M$|AC NphԗpGAC B$!AC G$ AC FDAC I$TہAC M$XAC N $̘AC G $0AC IL$TAC G#ԙx"47AC CT(AC Bt$|ȡˀAC M$p #AC GܚX"pAC F0^AC B4pAC Tplh`X8AC xԛpXAC B H $@$AC BDP$AC Bd`AC IAC I$VAC M$ԛ9AC M$AC C4pAC B$Tp2AC M$|AC M`$XMAC M%AC AC C$$0AC ML!dTAC F$AC JȻ$Ğ~AC P $cAC J$,oAC J$TAC K|BAC C$AC M$ğPAC M$AC MAC C$4PAC K$\AC K@ $8UAC MĠpYAC GAC G 3AC B$$@AC MLzAC Fl(PC $(AC M$eAC M$ܡX)AC M`zAC C$GAC CD\tAC $_AC J$AC G$AC M$$pAC J$LAC Mt,G[C B$AC M$ԣAC MX1AC B$ x;yAC F$403yAC C$\#yAC CĤ$ܤAC M`h4pLhDAC F$lAC J]AC F$PAC Mܥ$$`AC J$CAC MDoAC E$T@CwAC PoAC EXvAC G$̦\AC K$`AC J$(KAC G$DPAC MlAC I$AC K$@AC K$ܧAC MM5AC $sAC JD\AC F|AC LW̨C ph 4` LX $dPAC P|tAC Ph.w.w.G.j.V.J.W.f.z.@.W.X.O.R.b.q.k.].h.q..j.B.N.f.S..j..S.[.J.E.@.`...[.X.f.S.].O.J.].G.].s.].R.y.D.S.d.L.Y._.g.M.^.\.k.f.N.Z.X.^.X.^.X.U.E.[.m.b.A.J.k.[.].].\.d.V.].].K.h.G.{.d.m.d.W.R.z.v.f.z.Q.[..B.J.Y.{.D.u.}.h.g.H.d.O.k.W.Z.O._.q.b.b.W.Q.Y.N.J.J.E.Q.R.Q.R.S.G.H.^.E.K.J.V.b.G.H.`.E.H.$xAC J$#AC K$ܫ(8>3AC X>JAC C<>$D>tnAC F$|AAC MP_AC $IJBAC MC C xCAC $<xCAC M$dDAC MFAC F$GAC MԳ`I9AC CJ_AC FJ%AC B4JqAC IT0L)AC Bt@L8LXAC CxL1AC ̴LrAC E$L*AC MNLAC C$40NAC M$\OAC M$`QAC K(RAC B̵SXAC F$HSAC G$TAC M$,U#kAC CdVAC BVTAC C@VFAC BĶpVtAC GVpAC G WAC I$WAC IDXAC IdXAC I Y$(Y,AC MķPZܷHZ`>$ (ZAC K4 [ L[ d[AC I[AC I$@\AC J̸]jAC F]5AC C ^AC ,^ D^$AC Bd ^ |^$AC B(^&AC B8^]AC Fܹx^QAC B^OAC B^AC B<x_TAC C\_KAC C|_wAC BH`AC H`AԺ a ,`AE@Hm@IAlb4XbBAqH$Tb#AC P|c1cc3Ļc ܻcc Hd7AC B,hdDpd\dtduAC FPg XgAC ̼Xi$PidAC M laAC C$,nDAC P$TtAC P$|y{AC N`zAC I$ĽP{AC P~$~ AC K$,2 AC MT0BA$tAC M$8AC P$ľ6AC P.AC $$AC M$L(AC P$tAC P$XAC MĿPX$ܿ"AC G$LAC P,ȝAC JLhd`|XPH@8$0AC MGAC B<(AC B\(%AC C|80( AC ,$DAC KlAC ȠРȠAC  x$p$<xAC Jdp'AC C#AC CBiAC <8nAC F\tAC G$pTAC M$AC GZAC BAC F$AC CD@\HAC F$l[AC C`AC B`$X}AC J4Ld[AC B$tЪ3[AC CAC B$aAC G$aAC G8 40 L(d0!|HP!hp$$AC M@0AC B$PGAC BD $\xAC P$AC PAC I$HAC P$ AC P AC I$< WAC Pd |AC CAC C}AC B$<XfAC G$d AC J!AC Ih"X"$"AC M0&Ch&:$4&%AC M\+]t+](,  , , ,AC I$,AC Kx-AC I<(. T ."$l8.AC M$0/AC M00 $0rAC M05A,5D5\5t555A5A$5 AC P h=$p=<x=AC F\>AC F|>`AC C(?HAC C$X?AC J?$AC B??fAC <@6AC B\8@AC |@@ $@aAC M$CeAC J$XCcAC J$$CFAC JLC=AC C$lCAC M$DAC KFCAC F$HT AC P$@UAC P,ZDZWAC CdZ|ZZk[8AC B$[AC M\"6:E8l#6.AFVN偀  b)=;M 5W\\t5P+-8E=}{D(!H(!ڂ ~ |"zH1r 4A pK%z " :P&}{&!&! k `Xu^\ 5vG!xT> ^H Rf0.@ JOOgQtl|}{\%!`%!ii< Y YL\ia}$! 3 3 8 8)'@=c&;)'&&:(+րN^ {U0W)'6$+405Av{K4&&]G[I-IAQV3}uIIO&)Mv Nh 9P!-M V[TV'<E 2!u%*G%N*,+]05+]05+]05JsO,MR54``q3+]05LL d0[dd !!9N;(}{!!NN 4[['!#4.@ K)'.' 24) x}4) &7)'U *(l)'Y =)'S  k)'Y DÀA -$ <jÀA  ,jÀA  ,jQ9]Q9][[sxh}uMM`}1DC h11~=5-%(M hW}h!4+''[* DH :G.Ou  PP}X5}{!!? ] rP.  aH-   !<P5}{!!' <E 1}E(Gm  P}HuP5}{!!$ @B 2zE%Nj* PO|W5}{!!* BH 7H+Ms  PN{V5}{!!$ 6B +z B%Ag  PwBoJ5}{!!* H vTj, 2>p3GEW Iaff~IP#5+ALYQ}{d!h!* H vTj, 2>p3GEW Iaff~IP#5+ALYQ}{,!0!? d] S1 n uwju}w^ueU  Qv~7}{!!' E y}W5a 8Q7}{!!' E y}W5a 8Q7}{!!' <E 1}E(Gm  P}HuP5}{ ! !$ 6B +z B%Ag  PwBoJ5}{ ! !% = eg h w4HFX AbggAP2&9DQI}{ ! !+ JC ?LZX*c P|FtN6}{ ! !偀! 89 -EyCk} xxPU#M+2]p{}{ ! !偀! 89 -EyCk} xxPU#M+2]p{}{!!$ < df `qy"64F /PUUm/P 2'2?7}{!!)'6ف( %-.W du   ,$偀 >  FZXj MtyyMP' &/EP]U}{!!OO k ~#   1lm5bLmu5@m$5{m5 mLKb]r `|`Q:-#5BXchH Ql}{!!4<< tG-vt) qVi^ ~a  )')'< E!fPhC vIp\xapnpnf$Tx/ÀAbbu|4WR偀' ? R:1/A #KPPh#P+&3+}{P!T!N HfPF"Du ttQQ.I6#Ylw|}{X \ ' E )R / 9>>VqP& "}{T X )'JAA _ )$fzx Pc!V5^HTk}{4 8 Ntt#&$&$! $րNCC!XفV l _ujOAE6+#[c }phb}JuOA[Eu H C)!րN7 Mbg<IA9t=[D^HD4-Q;lTd\7 V bi{1\84h F[|OSRWDk]MGZ N2\GTL[\dIA9EX{fsk[I} O C -%hn3Q k]MGZ N2\GTLIAKX&P+<gtl[I!O&!C4A9Xf ajf=\UZfXwxf*^/M|[OO%C1>6o  f$FjaG.uMl]c{EcCX"I  G==RWO~ +tG R C&3+}uJ & 1HyBcaPCaj_yx_y<_cAU_~ aEa M aAMHHa8M WO$Swx&    > M9  *  M_ NN ]{ | Xc a%  @ ] G 7 { <       րNdV $@ $EhLH,X0[AHD"/'[A{H{EsJDI e 7 Y7<?LD}0 hk jx<jb.jM0})'55UJ)'HH(p'D 50 :I Sb ul x }}} @5 `  V*9 LC Op h}}}, )'==V?}u69 m; q- G)6.IA96<IA9;=?u`m & $7 9X 9] $@ $E & $7RP%TNQL`XH|E%Hj8JOUHHL J2HC()'kk vj p'CCzK7 +  w4 >pB} [iizT 5^8E=}X [U  } )' $[J t!Vw|}L ][ DÀAuu N &}u).(|S w*y5QH)' $ف 3 *ROu&cm@J   " 0hWyqi'akYQI4Alqc f f[yy#}, |f1i7)25E5z 5a5N5F 3Q J3g F5 + f"\Of!F%z5f'SOf#d9f$#51f #pu #MT|)'wZ! ^+00H ^T anf} 4*g6ÀA((a-Y %jAaHY & A $7Т0P@,,,, , P`P,8,,p@0p0@`F8,`,,`0P`p @,`0 `p@Pp,,`0 P`p @  ,@0 `p @ ,`00p 0P ,,, ,@@,`, @``м 0@Ppн @` @``,0P0Pp0Pp,, 8,@8,6677B7X7x7778(8F8d8-8889B9j9~999:T:z:::: ;4;^;;;<<<f< < < ,=F=`=~======"><F>d>v>>>>>?$?B?X?n?????@(@X@r@@@@@@@A*AHAfA|AAAAAIBB&BVBlBBBBBC4CNCfCCCCD(D@DddD|DDDD E:ELErEEEEYFPFFFFFGG0G@GZGGGGH2@HdHH NHH HI.IDIhIIIII*JRJ|JJJJK@KbKKKK > > 6? ? ? @ W@ @ @ &A TA B dB B 'C qC D LD D D IE E F F F ?G G G ]H H H eI I /J MJ J K TK K K K 3L `L L L L  M FM  ]M M M M M N jN N G N 'O fO O WP uP P \Q @R S e ?e @Cf A}f Bf Cf DDg Eg Fg Gh Hbh Ih Jh Kh Li MBi N\i Oxi Pi Qi Ri SYj Tj Uj Vj W5k Xk Yk Zk [k \ l ]7l ^ol _l `l am bSm cm dm en fOn gzn hn io jRo ko lo mo np oPp pyp qp rp s1q tkq uq vq wKr x~r yr z s {Fs |s }s ~s ;t ot t t  u Gu u u u v Sv v v 5w pw w %x ax x x x y Dy y y y  ?H @r J Pʑ Q R- S T Uْ V) W{ Xѓ Y- Zt [Ŕ  V  ɕ  # T     ? m !ї : ;" <s = >ߘ ? @G A Bϙ C DM E F GΚ H I J5 K L Mě N O PR `t a b cќ d e f( g; hT iz   ؝   ) F U t   ͞  `  ԟ * !V p    0 f  ֡ I n   2 _ ~ Σ   ,  E h   ! " #C $ % ' (\ ) * +A , - 0 8, 9 : ; <i =ī > ?r @ʬ A" B C˭ E Fv G H0 I J K_ L M Nq O Pr Q SZ T V WH Y [ \5 ]y ^ _ `{ a׶ b4 cD d4 e} f h i! js k l mҸ n p qn r# sU t u v2 wm xƻ y z^ { | }\ ~  U   o ο  - s    ' v   S   q     l   , l    l  !   X  /   D   0 z   @   $ 4 F Y    Y 4  \   J     !8   G {  1 f   q  i   [    = p   /    ,    @     N     0 U j  2       - A Z m x        4 _ s  ! " # $ & 'K ){ * + , -# .O /y 0 1 2 3 4 5& 6N 7r 8 9 : ; <A =T >k ? @ A B C D7 EP Fw G H I J' KX L M N O P% QZ R S T U V W X, Y9 ZV [z \ ] ^ _ `9 aV b c d e f4 g^ h i j k l m7 nQ oq p q r s7 ta u| v w x y z7 {W |l } ~     3 ]       ) ^      0 C T c v      * K x     Z     C u   f    > z    G     3 G Z   9 l    V    - m    H    R   1 {    ^  1 Q   4 \     6 H \         v 2  | 9  K  %  5 2    M ! ! # # !$ `% !' #) $R* %, &- (/ )0 *81 +2 ,[3 -b5 .7 /7 0@9 19 2j; 3< 4= 5= 6n> 7? 81? 9 :>? ;@ (@ ^@ @ @ A 9A B B ,B IB B B  C mC C C C D DD }D D D E 4E aE E E E E F BF !cF "F #G $ G %oG &G 'H (H )H *H -2I .eI /I 09J 1J 2J 3K 5SK 6K 7K 9L :L ;YL <L =L ?HM @dM AM BN CSN DN EN GO HIO IO JO K(P LP MP NBQ OaQ PQ QQ RnR SR TS US VT XDT YT ZU [4U \NU ]\U ^mU `|U aU bU c-V egV gV h W iYW jW kW lX maX nX oY pY qZ rZ s[ t[ u[ v:\ w\ x\ yL] z] |^ }&_ ~_ Y` `  a Za ua a a b b b b !c c /d d d Re e e f *f f g g h i {i i j k m n :p oq r r r r s Rs s s t wt t "u Mu u 0v v v 7w w dx y y y Pz ${ { | | } Y} } } #~ r~ ~ ~    9 u    9 s   9 g   <  Ѓ  P   ل ; u   % ^  ӆ ! "= #o $ %؇ &< '] ( )͈ * +K ,} - .K / 0 16 2 3 4 5o 6 7 8* 9 : ; <Z = >ڎ ? @n A B CG D Eɐ F Gd H I Jq K L MC Nh O Pۓ Qb RՔ    ĕ  ߕ   ?  e   ͖  E  m         ;  b    Ř   L  z      8 ! T " s # $ % ʚ & '  ( D ) ^ + ~ , -  . \ / 0 Ԝ 1  2 I 3 [ 4 o 5 6 7 8  9  : 5 ; i < Ҟ = >  ? & @ n A B ӟ C D  E " F D G [ H I ˠ K L  M v N O p P â Q R S  T < U V ӣ W X  Y g Z [ \ դ ] ^  _ O b c c ĥ d # e } f g  h v i j  k : l b m n o / p ȩ q  r f s t u  v Q w x y Q z ά { ܬ | } 4 ~  խ  î  Ѯ * ; J  Q r ư (  T !˲ ! !1 !h % %8 % % % %u % %K % % % %s % %p % %s %j % %# %j %$ %Z % %U % % %- %X % % & &% &, &4 /&Y 0& 1& 2& 3& 4&@ 5&j 6& 7& 8& 9&K :& ;& <&. >& ?&I @& A&8 'M 'y ' ' '# 't ' ' ' ' '( 'T 'w ' ' ' !' "'& #'5 $'s %'I &' '' ('" )'q *' +' ,'e -' .' /'! 0'V 1'w 2' 3' 4' 5'> 6'V 7'| 8' 9' :' ;' ` p@ p` pv p p p p p= p^ p~ p p pD p p pn p p> !pp "p #p $p %p &pS 'pp (p )p *p +p" 9pR @py Ap Bp Cp= Dpu Ep Fp> Gp Hp) Ip Jp Pp Qpl* Rp* Sp* Tp]+ Up+ Vp, Wpb Xp Yp ip q q; qZ qm q~ q q q qM qs q q q q !q5 "ql #q $q 0q 1q 2q 3q]. 4q* 5qG @qg Aqw Bq Cq Pq Qq Rq< SqN Tq] _q{ `q aq bq cq? dq eq fq gq hq? iqk jq kq mq nqE rq tq uq vq wq^ xq {q }q ~q3 qh q q q q8 qg qg q q q q; qn q q q0 qk q q q q q q< qS qw q q q qZ q q q qC qy q q q8 qq q q q% qS q q q q" qb q q$ q_ q~ q q q- qa q q q q qI qs q q q q8 qq q q q ql q q q" qJ qm q q q q qT q q q q4 q` q r r r7 rR rl r rX r r r r r r( rO r r r r rT rr r r r[ r r rM rj r r r !r "r! #rK $rn %r &r 'r (r? )rZ *r +r ,r -r .r /r6 0ru 1r 2r 3r 4r 5r 6r7 7r 8r 9r :r  ;r` r ?r  @r" ArI Br Cr Dr Er Fr- GrQ Hrq Ir Jr Kr Lr Mr  Nrci Or! Pr8 QrY Rrp Sr Tr Ur Vr Wr XrF YrY Zrk [rt \r ]r ^r _r `r ar7 brR crr dr er fr^n gr hr ir0 jr` kr lr mr nr or pr7 qrU rr sr8q tr ur vrC wr xr yr zr( {rM |rl }r ~r r r r r9 rk r r r r r r rM rf r r r r r% rC rg r r r r rL rr r r r r! rC rj r r r r r+ r^ r r r r  rP r r r r r* rQ ru r r r r  r rA rz r r r rH r r rd r~ r r r r? rg r r r rZ r r r# rE rw r r r r r! rR r r r r  r< ro r r r r r r) rL r rh r r r r r r2 rF r r] r~ r r r r r1 ra r r r r% rJ rm r ru r r s s s/ sI s` s s s" sU s s s sj! s! sg" s" s" s" s# sB# s# s# s$ s)$ sY$ s$ sM% !sv% "s% #s& $s<& %s& &s& 's& (s%' )sq' -s( .s2( /sZ( 0s( 1s( 2sP) 3s) 4s) 5s'* 6sB* 7s8 8s}* 9s* :s* ;s+ s, ?s", @sJ, As|, Bs, Cs, Ds - Es-- FsK- Gs- Hs. Isd. Js Ks. Ls. Ms / Ns-/ Osl/ Ps/ Qs/ Rs/ Ss0 Ts-0 UsN0 Vs|0 Ws0 Xs0 Ys+1 ZsP1 [s1 \s1 ]s1 t22 tP2 t2 t2 t3 t&3 tG3 tɕ t te3 t3 t3 t3 t3 tH t4 t t$4 tB4 t_4 !tx4 "t4 #t4 0t?5 1tg5 :t5 ;t5 tߘ ?t @t6 At,6 BtZ6 Ctx6 Dt6 Et6 Ft6 Gt7 Ht7 ItB7 Jt5 KtW7 Lt7 Mt7 Nt7 Ot7 PtR `tt at bt ctќ dt et ft( gt; htT itz t t t؝ t t t) tF tU tt t t t͞ u7 u7 u7 u#8 u_8 u8 u8 u8 u8 u9 u09 uX9 u9 u9 uX9 u9 u: u$: u:: uQ: uh: u: u: u; uH; ur u; u; !u; "u; #u< $u:< 'uf< (u< )u< +u< ,u< -u"= 0uP= 1ud= 2u= 3u= 4u)> 5uX> 6uw> 7u> 8u@? 9u? :u? ;u? @u @ Au"@ Bug@ Cu@ Du@ Eu2A wu}A xuA vaB vwB vB vC v;C vzC vC !vC "vC #vD @vJD AvqD wD wD wE w6E wjE wE xE xF xF x x x x4 x_ xs x2F !xcF "xxF #xF $xF &x 'xK )x{ *x +x ,x -x# .xO /xy 0x 1x 2x 3xF 4x 5xF 6xF 7xG 8x 9x :xAG ;xkG xk ?x @x Ax Bx Cx Dx7 ExP Fxw Gx Hx Ix Jx' KxX Lx Mx Nx Ox Px% QxZ RxG Sx Tx Ux Vx Wx Xx, Yx9 ZxV [xz \x ]x ^x _x `x9 axV bx cx dx ex fx4 gx^ hx ix jx kx lx mx7 nxQ oxq px qx rx sx7 txa ux| vx wxG xx yx zx7 {xW |xl }x ~x x x x x x3 x] x x x x x x x) x^ x x x x x x0 xC xT xc xv xG x x x x x* xK xx x x xH x\H xZ x x x x xC xu x x xf x x x x> xz x x x xG x x x x x3 xG xZ xH xH x9 xl x x x xV x x x x- xm x x2I xfI xH x x x xR x x x1 x{ x x x x^ x x1 xQ x xI x4 x\ x x x x x6 xH x\ xI {J {RJ {J {J {J { {K {4K {VK {qK {K {K {K {K {L {@L {hL {L {L {L {M {6M { {LM {M {M {M {M {M {N {-N {چ !{PN "{xN #{N ${N %{N &{N '{f ({O ){@O *{pO +{O ,{O -{ P .{MP /{P 0{ 1{P 2{Q 3{ 4{cQ 5{Q 6{Q 7{ R 8{8R 9{ :{{R ;{R <{a ={ >{ ?{' @{u A{R B{,S C{_S D{S E{S F{ G{S H{S I{,T J{{T K{T L{T M{J N{o O{ P{T Q{NU R{y |U |U |U |V |dV |V |V |W |1W |eW |W |W |W |+X |TX |yX |X |X |[Y |Y |Y |$Z |EZ ||Z |Z |[ |u[ !|[ "|\ #|:\ $|p\ %|\ &|\ '|#] (|\] )|] 0|] 1|^ 2|L^ 3|^ 4|^ 5|_ 6|b_ 7|_ 8|_ 9|_ :|A` ;|x` <|` =| a >|Ja ?|a @|a A|b B|Cb C|b D|b E|?c F|c G|c H|6d I|vd J|d K|d L|2e M|qe N|e O|e a|If b|tf c|f d|f e|f f|g g|Gg }og }~g }g }g }g }g }g }h }h }4h }Yh }vh ~h h h i ^i i i i 5j j  k :k ck k k 1l fl l l m Nm m m m )n nn n n !n mEo o\o po {4p }p p p #q Z=q rq pq qq  8r  br  r r  r "%s ) P,         ( ,X(,o( -pzX*`P o(oo(oo&o 8>// i % 5=p@/ SP-l{@/ p-X \     HB/ @z6-J :e-  }DB/ \  / V/0 M/E /[ B/u ^/ - 0- (-  -1 -@ 1 l ip i u{ u     u2 ī 8  Fn -\ v7 -    'ܫ !  PC  e    @3  3  R  0 Pr @v75 @`  /i8    D   p  k* 0f1  C D ' ķ i< ` s W n//(//* /< C   Ȼ % = f` T P ,cF,C    , 1  iD p *п  =8/Q8/h R  8/Ck| ?,0$:/ :/ `@u3,J9/dq(:/0:/i |  :/:/T  <   *0 2\ t  M E ` `@  U Fjp/ y//fp- # P, @} #8,/ Sm >,s f~ @   to   h 6 /W y  , 0%6 @ P `On r p9 i@,   jE @q} L,   Q   @E|/) SB g P P p @  = `6` # pB  , ,2 [-w     t,: GVH, up x:/ 0  P)  `%x  7 ,  ! @ ! 0E!,! @9! Pz ! \! V  " " dV" o"P," ,"." 1",,#$/?# NM#d# # M# # \$,C$ f$ `uMq$Ȱ-$$ O$ V$ȷ-%% @Z)*% r% p )% Pmn% P% 0].&а-Y&,x&X/& (& &:/'P,1'@,^' '  ''  (,1(@C(,j( fw( 6o(H,(() C&)-K) pZc)-)H,) < ) p2) e;* @tG* |T* A{* .* *(,* 0+,+,L+/@W+x,+ p$+,+ !+p,, p+7, pC, ph, P=,HC/, ",  , %- 0 "- 0?- .k-p--غ-- - \- C.(.,N. Ph.;/{. p. .(,/ $^/ м/ ` &/8,/ / `V0,70 S]P0 Z0 0  0 M0 `0p0 -1j1-1Е/1 Xa1 6}1 P1 1 2 ^2 QA2 pYw2 A2 2,2 3 PMr3 ii3 R3 0 3 `<,3 03  *4 9V4 @Gvl4h,4 &4 @ 444H,5 P{45,c5,5 e5 ?5 0[6,D6 p[^6@,6 E66,6 7 @D[*7,W7  77 7 ``8x,D8/]8 Zu8 8 c8?/9 $ 9 x,9,S9 H9 P@9,9 9 Pr?9 : $::\: ` f:(,: ! :`:, :P, : p"3;,^; 0~; ; c< "< A/<,m<  < Pg<=,;=@V=  ^= pp= Sx= 00= =  > 9>ds F> w> =>> \>-> >p,? 1? >? `\S?P,??  ?,!@C@ hX@ @@,@,@P,@,A  GA a[A =aA,A/A 06A 0A B9/ B ,KB ymB`-B,B,B 0tC f'C 0$ C UC C C pCC ,D `?D yD pSD 0WD pDD 0@D8,E P E,8@E 2oTE-yEPE PAE,E ЬE F`#F eF e{F,F PF|F,F F @GT.-G 7G=/ @G OG 3mG G p6G,G $H8H  fH 0LnH @H pH WH,Ix/"I 6 6I,`I@-I I p@*IP?/I 5cKJ !HtJ PTJ iJ `eJ н KBK [WK 05mK K,K p-K,L -1>L,lL L(,L @LL L /M +TMkMM 1M M9/M  N ` )N pCMN,(mN N,N,N ')O |0EO`,OH,Oh,OA/OP #8P lPP `P P # Q>/h(Q 1Q UQ 0Q R w1R 0YR  R pRpR 0,S SS 8S` "^S PS ZSS(,T @2YT trTpT TF T zT kT U \U AtU U xU 08U FU vrU *VVZV P}V V `cV )<V `:GV8>/hV PWP9W,cW W YW PX)Xh,SX $qX g X 0 X SX `_Y ;Y `TY oY GY -Y,Y SY  Y 0Y PZ-DZ 08XZ @  Z [+[ `U[ @m o[ f[ [ p[ 0 [ 1[ 0\ 2\PF\8,{\ \ 0v\ \ ] F],C] "z] ] (]-] `  <^ G^ @1^ M^`,^ ;^ p _ =K_ jZ_-p_ )_8:/_,X_ PT_ @_ |` PA` `][` ` H`/` 9`.a P$Ia 5a a `/a ab44b Ib @Pbh,xb b Lb b-c,Pc Pc,c $c xQc )Ic p+d _1d Nd-]d Dyd  d dX,e  Ue Pbe.e@e POe e,f $f Df @{ \f f<f f f P f yf 1Tg Xog`B/(|g $g jg sg`g `1hx,Eh pvhh/h 0h,i n]i`,?i8,ni Ti Ei Gi  i @ #j@8j 3Nj @hj Rj _j,j  jk %k-Kk Zk(,kk ek PSlX,l e4l Xl awl &l@,l l$m 0Zm cm Rm 0cm ~Xn pkn 0Svn Nn `n ` n fn@!o `J%ox,Po Cyo 7oo,o oX, p !.p frpA/p@p "p0,p p2eq `*q LQq pf[qwq sq $q Puq  r `\ rp,Hr t#ir 0 xr-r @s'9s Rs P^s 5is,s s Y sH,s s0t `hJt g_Xt t jt @uȧ-u,Ju,ru @3u \u v PZv ,v pv  v Fv 'w 2w,[w w @(w@- w8,w@,w Rx 7x ?Nx P=Tx #]x }x txx,x ` y -6y )ly `y 0y `y z z Ctz(,z z:/ { "{, 6{  Z{ c{ @l{{ G{ [9{ { @1{ !| ?| 0 J| ,u|  | @| @g|  },<}X,_} `} ,} e}, } @~ D~ e~,~ 0~  ~ ~ P)   ? p;V  P,,(,C PY 0| P G@,,ـ(/:/  h-4/G  a { 08  `, !,HB vmY,  ,ق f  `a P @l ׃ к  0% p„ @ ̄h,h- P % t,υ,p `*J 2]/  `̒  , - (X m t. |a @ Paܓ p$ `kY pq 2 `Q.ʔ 7,- 06,a Rs @N p @ Pҕ \ R p02 e :; @yÖ-ݖ  J@a Sn,} 0 { `"ԗ @X  A, @T`,, ppn ,֘ ?,HV t,p,™, `B p60J S .  ;; ` 3 p`Q,j @*}, XÛ 0F @' aX/g ` r, @ j 8Ӝ ,6 `(, 0/!X,(A,j Q  P-,4./,?, Z dd  m  ɟ8,(, `@/h ʠ p ;CEZ @   pGX,m Pc| 06p-(,ը B/0@+ P.w;,g ^ p CP,8   U O #̪x-, hK 06˫  p `P ;`8, )c  ׬, A/  4 P  (x;/ޭ  P} ˮ,,H[,(w x P z8з-T`j p`,ذ` VH-< `@, PJK P[D±  0 . `VR4  T P*A_ pA 0 (/ ֲ  28 K 6j |yp, pγ Y( % t6 PO P'_ + PLh/  p @ &&p: Ic }`, ,Ե w (W Pp ;/X@,  0&k0 ! * #_ 8ȷ,.0 `h Gu 0] 0 >,= H`V f  YϹ O P3 WH `jc y 0L P# @1  P @Yx-eh,  /û pK=ڻ 1D/ `R,q @  7A,l p=o  4R Eý @%8, " 0  R0,| ",  ,I ГV u, P@߿  X,  @` V /x, 6 п h! P ,, Z ` 0f 4@, E PKQ      P 2 > M { l j  |&,C      P7 `A-` @k 7, )   С@,1 @ M 7a`,   `  Ч% +26 P B B/  @r p1 ШHW @0| о PXA/ pll @v6& >.X  U a,A,s, g sn@-(  pd R ~r5,`` p $ 0E $ k;p, D, { u @ 0 ,,A [ #G `6 - 5M Z p8  0e d  X P  &X,Q,w p P4 p    3 Z s  0^A/y 2, P  Ns. aJ snj @ 7 H 0> PR70 * Q \ k z  d m,  K oa-x8,  @8 % @ c 0:t p\,`, x t=,- ,  `t; :iy;/ ` 5 P 2, p&X/ ; Z R t,     NE `U n~ ,, @  @O @Fu,  `  @u ,+ XXB aa {   Px @{r pt+ `1$> p:YQ-k 4 [ S pC w p,  [6  O,H:/ M , 1P f tw ` u$  u0,B/@ , о ) P/N Y PGK  P / ,,!#,BV n  `; w PO j-6 PMe i  P, Fo ! $+ T~8/ g1 M9 0J b>z8, ' `q, , ^>B/S p    PD  P 0A!,E,l pB В  ,5 I uU u P -, u  -1 L 07@i Az -, ' i$6  f  ~  @  s0P,L ![  [  $,- 0/Y $f `  @ 0\/ `UW9/: S m !X|x-  `D   (  -$ 00@,W P@ =/' `7 $ ,J )jT y  `3 o 0  % `C6 3G-\ P, @ @]   & k8 @[M 7cZ @c, T  P 6 6u U Cz  -/ @nPD Pu9/ P H=/h = <H `/ ,  - Ж9Kx,ȕ @ M  x @`v HK  ID 2 w~C 0s ) P w~X/P  @ ,!,0G f =w G   - * y .0C/ ,8,!05I (^ 0y [D -,( DK @3d T~ l P [ 2`,1 nJN N~ 0,p,H,H  $Q-qX, CY v RH?/>h,l p\,  ,,'o 0  4$ h9 `#/ T[, v - e ' p1 Po/0N >v  @0̨- 5 P^I q ~}H,,0 0   A bp~ @ R[ - o# '|6 0@V, x  @s ,,3 Фn,@"P,0' 0Kc PY`,8  p8, ` /h4 @rM -1t p3 p 0W;/ ,, '#,i zp, 0# $[ ph p# p P  e Ax 0,    w   ,8  :L  @y  P  & ,  , $  ]A ]  @f  @i ,    4 -.  v6=  /@` p!  "   $   - 8-$  C B/hY  0  .   MT  PB  C  ,& S< 0.c `2x, В' Y 8/ Z* A,]   @h @\ ,> @IV a T  7.8,Z u `@, P ~ <X,C @ O0/_  p 3 (G0,-/ @J(, R:pY CGj L `, U% J2 0#d>  PA/[ p @J   j '  Um, `F P:W jP~ P.  8  3F T\@:/p ` /P, x,A py >,h,- `ei{  Y -x, eW- p,- 5} P  !^ P d.  Ќ5H,c 0?/ w Дf,",K `b V =ts  % 4o%p>/Q-c0n   d H,  I  `=  0W  0~sj  2  p: , ;/  p! _r5  5 PK 6 6 6 P6 7 В'@7,|7`'7 P7 7 0 7 :?8 en80,8 G8 @T$9 `ZL9 9,9 9 `@9 0S9 p:xC/: X<: P h:@/(: {: : ; b<; liI;к-w; S; ;D.;;  < &< "[<0p< p~b< p< @<-<3= `k= E$=P-= = @= =x-= gM'> 3> {K>,> > @#>,> Ж>@?/'? \?P/r? ? ? Ш?,@ 8`K@ t@,@ p} Ap,*A qA POA `|A PA A B pB,B  C I:?C PQ `C jC @CP,CXB/D/H*D n`@D ptD 3>D#DD@D D йsAE E  E $E $E,F .F YF @ F@B/FF OF P{G 0)G ,ZG/HnG w&zG=/hGD:/G8,G 0iQG  H,;H SH H %I :!I jqI PI P\I(/I pJ 33J `YJ [pJ ph!J,J J, K @ =K /FPK 0vK@,K %K @Lh,>L 47QL L `#L p4L !L @[jL  ?M-RM oM 0M P!N0,@NQN YkN wN N P N N,@N@ / N 9O @siOH,O `+#O,OO , O`,1PȺ-iP p P *<P 0P p?Q t9Q 0-LQ,qQ/Q @Q Q RNQ `R `R VRmR `S zR8,Rx,R @R `0S,;S @S-S,S  S T p4T `0kGTdOT rT ;T %Tp,0U *4:U @ gU @\U`,U pU PU U 0V @V  V :V (HvV !V  V 5KV 6wV  WW  4W,_W OW 0W,W /W `W 0W X FX `OX  fX `X pXC/XX $X 9#Y GY p=tY vY Y,YȨ-Z 8Z8JZ vkZ 9/d}Z,ZPZZ p5Z l^Z ![  A[ e[ Oz[;/[-[ Gi[p,\`-*\ (0\ 3F\ PQZ\ @xJq\ C\ /\-P\ ]8],[]] `] ]  ^ P(^ 8S^,~^P,^P^-^, ^ _,A_ __ mw_8,_ p` $`6` a` #(&((X* z ( P  x 8 D} ,,(,8,@,-P----```` a"a5aIaja|aaaaaabb@bVbjbbbbbbb c&c 5c Ic\c}cccc pccd'd:dTdidddd Fdddeee7eJeoe peeeeef#f p^1f 06Mf`ffff fff gg1gGg[g ugggg g h)hMh Mahxhh"hhhh*i K